KEGG   Micromonas pusilla: MICPUCDRAFT_49639Help
Entry
MICPUCDRAFT_49639 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
mpp  Micromonas pusilla
Pathway
mpp00061  Fatty acid biosynthesis
mpp00780  Biotin metabolism
mpp01100  Metabolic pathways
mpp01212  Fatty acid metabolism
Module
mpp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MICPUCDRAFT_49639
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MICPUCDRAFT_49639
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mpp01004]
    MICPUCDRAFT_49639
Enzymes [BR:mpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     MICPUCDRAFT_49639
Lipid biosynthesis proteins [BR:mpp01004]
 Fatty acid synthase
  Component type
   MICPUCDRAFT_49639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N Thiolase_C PnpCD_PnpD_N
Motif
Other DBs
NCBI-GeneID: 9685505
NCBI-ProteinID: XP_003060067
JGI: 49639
UniProt: C1MVN2
LinkDB All DBs
AA seq 467 aa AA seqDB search
MAALASSTIIGARGVVANRRVISARTSAGSGSRAAGRRTIVVVNMARETDPKKRIVVTGM
GLCSVFGNDYDKFYDKLLAGESGVDMIDRFDTEDFPTKFAAQIKDFDNEGFIDKKNARRM
DNCLQYALVSGNKALLDAGLDDDAIEKLDKTRVGVLAGSGMGGLTVFQDGVKALVEKGPK
KITPFFIPYAITNMGGALLAIEKGFMGPNYSISTACATANYCFHAAANHIRKGEADIIVA
GGVEAPIIPVGLGGFVACRALSSNNDNYKGASRPWDKGRDGFVMGEGAGLLVLESLESAQ
KRGARIHAEYLGGAVTCDAHHMTDPRPDGSGVGLCITKAVEDAGIDISEINYINAHATST
LVGDVAEVNAVKKAFNNKLDGVKMNGTKSMVGHCLGAAAGVEAVATIMAIKTGWLHPTIN
QEDSIDEVADIDTCPNVKVEHEVKVAISNSFGFGGHNSSCVFAPFEA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgctcgcgtcgtccaccatcatcggcgcccggggcgtcgtggcgaaccgccgc
gtcatctccgcgcgcacctccgccgggtccgggtcccgcgccgccggccgccggacgatc
gtcgtcgtgaacatggcgagggagacggatccgaagaagcggatcgtcgtcaccggcatg
ggcctgtgctccgtgttcgggaacgactacgacaagttctacgacaagctcctcgcgggg
gagtccggcgtggacatgatcgatcggttcgacaccgaggacttccccacgaagttcgcg
gcgcagatcaaggacttcgacaacgaggggttcatcgacaagaagaacgcgcgccggatg
gacaactgcctccaatacgcgctcgtctccgggaacaaggctttactcgacgcgggtctg
gacgacgacgcgatcgagaagctggacaagacgcgcgtcggcgtcctcgccggcagcggc
atgggcggcctgaccgtgttccaagacggcgtcaaggcgctcgtggagaagggcccgaag
aagatcacgccgtttttcatcccgtacgccatcaccaacatgggcggcgctctgctcgcg
atcgagaagggtttcatgggcccgaactactccatctcgaccgcgtgcgcgaccgcgaac
tactgcttccacgcggcggcgaaccacatccgcaagggcgaggcggatatcatcgtcgcc
ggcggcgtcgaggcgccgatcatcccggtcggcctcggcggcttcgtcgcgtgccgcgcg
ttgtcgtccaacaacgacaactacaagggcgcgtccagaccgtgggataagggccgcgat
ggattcgtcatgggcgagggcgcgggattgctcgtcctcgagtcgctcgagtcggcgcag
aagcgcggcgcgaggatccacgccgagtaccttggcggcgccgtcacgtgcgacgcgcat
cacatgacggacccgcgaccggacggcagcggcgtcggtctgtgcatcacgaaggcggtc
gaggacgcggggatcgacatctccgagatcaactacatcaacgcgcacgcgacgagcacg
ctcgtcggcgacgtcgcggaggtgaacgcggtgaagaaggcgtttaacaacaagctcgac
ggcgtgaagatgaacggcacgaagtccatggtcggtcactgcctcggcgccgcggccggc
gtggaagcggtcgcgacgatcatggcgatcaagaccgggtggttgcacccgacgatcaac
caggaggacagcatcgacgaggtggcggacatcgacacgtgcccgaacgtcaaggtggag
cacgaggtgaaggtggccatctcgaactcgttcgggttcggcgggcacaactcctcgtgc
gtcttcgcgccgttcgaggcgtga

DBGET integrated database retrieval system