KEGG   Micromonas pusilla: MICPUCDRAFT_58175Help
Entry
MICPUCDRAFT_58175 CDS       T02696                                 

Definition
(RefSeq) intracellular chloride channel family
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mpp  Micromonas pusilla
Pathway
mpp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MICPUCDRAFT_58175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpp02000]
    MICPUCDRAFT_58175
Enzymes [BR:mpp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MICPUCDRAFT_58175
Transporters [BR:mpp02000]
 Other Transporters
  Pores ion channels [TC:1]
   MICPUCDRAFT_58175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C GST_C_3 GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 9683981
NCBI-ProteinID: XP_003058542
JGI: 58175
UniProt: C1MRP1
LinkDB All DBs
AA seq 442 aa AA seqDB search
MATATLPAAPSWDELKSAAAGTETGMKIAAEEELRAKGEGPAHVKAKLRLFGAKEEDVRL
TFYRDHAGWCPYCQKVWMMIEEKKIPCRIERINMRSYGDKPDWFLKKVPSGLLPVIELDG
EMMTESLVIMQVLEREFPDIPMLPEGQFERANTLLRLERQLFSDWCGLVFRPSMPGPFGG
GGRKTFEETFDKVDAALGEMDGPWFLGGDTPSIVDLQYVSHIERMNASCLYWKGMNLRGQ
ERWANIEKWFLAFEERPSYKACKSDYYTHVMDIPPQYGPGYSDSGKEVEDAQRAIDGDTT
WVLPVNLSANDLEPTPDSMNASDEAARHEAAYMLTANAKAITKFACRGKGEKGAKQFGAP
LADPYAVPNLNYESKVDELLRVTASLLLDGTAEPSGGKTSQDGADVAKCLAYLRDRIGVP
RDMSYPAAMQLRAHLNYVMDAV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcgacgctgccggccgcgccgagctgggacgagctcaagtccgcggccgcg
ggcacggagacgggcatgaagatcgccgcggaggaagaactccgcgcgaaaggcgagggc
ccggcgcacgtcaaagcgaagctgcgtttgttcggcgcgaaagaggaggacgtccgattg
acgttctatcgcgaccacgcgggatggtgcccctactgccagaaggtgtggatgatgatc
gaggagaagaagatcccgtgcagaatcgagcggatcaacatgcgaagctacggcgacaag
ccggactggttcctgaagaaggtcccgtcagggctgctccccgtcatcgagctcgacggc
gagatgatgacggagtcgctcgtgatcatgcaagttctcgagagggagttcccggacatc
ccgatgcttccggagggccagtttgaacgcgcgaacacgctcctgcgcctggagcgtcag
ctcttctcggactggtgtgggctcgtgttccgaccttcgatgcccggcccgttcggcggc
ggcggaaggaaaacgttcgaggagactttcgataaagtcgacgccgcgctcggggagatg
gacggtccgtggttcctgggcggcgacacgccgtcgatcgtggaccttcagtacgtctca
cacatcgagcggatgaacgcttcgtgcttgtactggaaagggatgaacctcagaggacag
gagaggtgggcaaatatcgaaaaatggtttctcgcgttcgaggagaggccgtcgtacaaa
gcgtgcaagagcgattactacacgcacgtgatggacataccaccgcagtacggaccgggt
tattccgactccggtaaggaggtcgaggacgcgcagagagcgatcgacggcgacacgacg
tgggtcctcccggtgaacttgtccgcgaacgacctcgagccgacgccggactcgatgaac
gcttccgacgaagccgcgaggcacgaggccgcgtacatgctcacggcgaacgcgaaggcg
atcacaaagttcgcgtgcagggggaagggggagaagggcgcgaagcagttcggcgcgccg
ttggcggatccgtacgcggtgccaaacttaaactacgagagcaaagtcgacgagctgttg
cgggtgacggcttcgctgttactggacggcaccgcggagccgtcgggagggaaaacgagc
caggacggcgcggacgtggcgaagtgtctcgcgtatttgcgcgacagaatcggtgtgcct
cgggacatgtcctatcccgctgcgatgcagcttcgagcgcatctgaactacgtgatggac
gccgtgtga

DBGET integrated database retrieval system