KEGG   Micromonas pusilla: MICPUCDRAFT_59369Help
Entry
MICPUCDRAFT_59369 CDS       T02696                                 

Definition
(RefSeq) set domain protein
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
mpp  Micromonas pusilla
Pathway
mpp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    MICPUCDRAFT_59369
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpp03036]
    MICPUCDRAFT_59369
Enzymes [BR:mpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MICPUCDRAFT_59369
Chromosome and associated proteins [BR:mpp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MICPUCDRAFT_59369
   Polycomb group proteins
    PRC2-EZH2 complex
     MICPUCDRAFT_59369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC Dicty_REP DDRGK
Motif
Other DBs
NCBI-GeneID: 9685186
NCBI-ProteinID: XP_003059747
JGI: 59369
UniProt: C1MVG4
LinkDB All DBs
AA seq 1212 aa AA seqDB search
MAPRARASPGDLPQTAVSARSLDSMEALALADDDAFRRVVFRALAALRKIFSNQQKNWAT
LRLRANVGPTTRASEAVAATVLAGASASASPSIPDRGADERAILPWNNKSRAHVSVSVRR
FRAGPLEGAMEERQTVEATALPLAKNVPRYTSYIYAASGNAYVQDEVQRRLLFPDHEGEM
RVASDEDSDSEGSSSSEMEESESDGGGRASANAGPEKKRRMNDVAKKRADEKARRRELRE
KNRETREKKEREDQERHWEEKEDYLVWASSACVGTSARAIEVTAEYLKVSPQMLKARLHV
LRKQADVGGGTGTGTGGGGGGGGGGDKTGNGGGTPNGLVPCEAARDAFLANAHARAVRDF
ELGARASAEFKLAARRLRVGGGGTEDDDVIEVKEETDEASVIESLDAATTQGRASDSDDD
DDESPSSSSPAARRTTRGGGGGGGGQNQSPGLKRKRSERGAVVDPSGRPPRPIATASPHG
SSAVIDAETSALWALVAWRFLRHHAVSAADLMMTAPPYAAVEPAMDSFRALYCVRCHEYN
CNLHGCGQRLPRSRDAAAAAQGTGTGTGTSARARAKDKDMSQQDALDDACPEGVDPPPEA
NPCGPDCWRMRGLRDGGAFLVFHAKSVRLVAELAMNKRLNVAEEAKQMCLEAEEDAAAAR
EALERSEAAAKFMDDAPVRKSARGKPAAGDGRGTGAKGSSAKKKTGTGTGSVGKGGKHRT
KDLNKLTMGTHAEDVSEEEEEEEEEEEEATTMTTTTTTTTTTTKRGARSRPEAQKNAPVA
VAERKAAAAAVEKAAAAKQYAAAKADEAVPSDARRVSSTWTDFHESFYIKMRRVYGEDAD
PCAIARAMRAPDAPKCHEIQARVRADVVADAEHAVVEARRRERDGSATAGEGVDNADDER
GGRGGRGGRGGRGRKGGRRAMKKRGTSQRKRTTATVRRRIANSEDHVWIQYSPCTCDGPC
DERTCLCIRDGNFCERYCACGGSCSNAFTGCACLRGQCHTRACPCFAAARECDPDLCKRC
VATTATIAHDAREGWPFTDLCLPVPPPPEVPTEGPNARGDPTESCVNMKLLLRQRKQICL
GVSAIAGWGAFLKDGAKKNELLGEYTGELITQVEADRRGKIYDRVNCSFLFNLNDQWCLD
AHLKGNKLKFANHSATPNCYAKVLMVRGDHRVGIFAKDNIAPGEELTYDYRYERDKAPAW
AQSDEPAGPLVY
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcgcgcgcgcgcttcccccggcgacctcccccaaacagcggtctccgcgcgg
tccctcgactccatggaggcgctcgcgctcgcggacgacgacgcgttccgtcgcgtcgtc
tttcgcgcgctcgcggcgcttcgcaagatcttctcgaaccagcagaagaactgggcgacg
ctgcgcctgcgcgcgaacgtcggtcccacgacgagggcgtccgaggcggtcgccgcgacg
gtcctcgcgggcgcgtcggcgtcggcgtcgccgtcgatcccggaccgcggcgcggacgag
cgcgcgatcctcccgtggaataacaaatcgcgcgcgcacgtgagcgtctccgtccggcga
ttccgcgccgggccgctggagggcgcgatggaggagcgacagaccgtggaggcgaccgcg
ctgccgctcgcgaagaacgtgccgcggtacacgtcgtacatctacgccgcgagcgggaac
gcgtacgtccaggacgaggtgcaacggcggctgctgttcccggaccacgagggcgagatg
cgcgtggcgtccgacgaggactccgattccgaggggtcgtcgtcgtccgagatggaggag
tccgagagcgacgggggggggcgcgcgagcgcgaacgcgggaccggagaagaagcggcgg
atgaacgacgtggcgaagaagcgcgcggacgagaaggcgcgacgccgcgagctgcgcgag
aagaaccgcgagacgagggagaagaaggagagggaggaccaggagaggcactgggaagag
aaggaggactacctcgtctgggcgtcgagcgcgtgcgtcgggacgtccgcgagagcgatc
gaggtcaccgcggagtacttgaaagtgtccccgcagatgctcaaggcgcggctgcacgtc
ttgaggaagcaggcggacgtcggcggcgggaccgggaccgggacgggcggcggcggcggc
ggcggcggcggcggcgacaagaccggaaacggcggggggaccccgaacggcctggtcccg
tgcgaggcggctcgagacgcgttcctcgccaacgcgcacgcgcgcgcggtgcgcgacttc
gagctcggcgcgcgcgcgagcgcggagttcaagctcgcggcgaggaggctgcgcgtcggc
ggcggcgggacggaggacgacgacgtcatcgaggtgaaggaagagacggacgaagccagc
gtgatcgaaagcctcgacgccgcgacgacgcaggggagggcgtcggacagcgacgacgac
gacgacgagtcgccgtcgtcgtcgagccccgcggcgcggcggacgacgcgcggcggcggc
ggcggcggcggcggtcagaatcagtccccggggttgaagcgcaagcgaagcgaacgcggc
gccgtcgtcgacccgagcgggcggccgccgcggccgatcgccaccgcctcgccgcacggc
tcgagcgcggtgatcgacgcggagacgagcgcgctgtgggcgctcgtcgcgtggcggttc
cttcggcaccacgcggtgagcgccgcggacctcatgatgaccgcgccgccgtacgccgcg
gtggagcccgcgatggattcgttcagagcgctgtactgcgtgcggtgccacgagtacaac
tgcaacctgcacgggtgcggtcagaggctgccgcggtcgcgggacgccgccgctgccgcc
caagggacggggacggggacggggacgtcggcgagagcgcgcgcgaaggacaaggacatg
agccaacaagacgcgctcgacgacgcgtgcccggaaggagttgacccgccgccggaggcg
aatccgtgcgggccggactgctggcgaatgcgagggctgcgagacggcggcgcgtttctc
gtgtttcatgcgaagagcgtccgcctcgtcgcggagctggcgatgaacaagcgtctcaac
gtcgcggaggaggcgaagcagatgtgtttggaggcggaggaggacgcggcggcggcgcgg
gaggcgctcgagcgatccgaagccgcggcgaagtttatggacgacgcgcccgtgcgaaag
agcgcgcgagggaagccggccgcgggggacggccgggggacgggcgccaaaggttcgagc
gccaagaagaagaccgggaccgggaccgggagcgtcggcaagggcgggaaacatcggacg
aaggatctgaacaagctgacgatgggcacgcacgccgaggacgtctccgaggaggaggag
gaggaggaggaagaggaggaggaggcgacgacgatgacgacgacgacgacgacgacgacg
acgacgacgaagcgcggcgcgcgctcgcggccggaagcgcaaaaaaacgcccccgtggcg
gtcgccgagagaaaagccgccgccgccgccgtggagaaagccgccgccgcgaagcagtac
gccgccgcgaaagcggacgaggcggtcccttccgacgcgagacgcgtctcgtcgacgtgg
acggactttcacgagagtttctacatcaagatgcggagggtatacggcgaagacgcggac
ccgtgcgcgatcgcgcgagcgatgcgggccccggacgcgccaaaatgtcacgagattcaa
gcgcgcgtgcgagcggacgtcgtcgcggacgcggaacacgccgtggtggaggcgcgaagg
cgagaacgcgacggctctgcgacggcgggggagggcgtcgacaacgcggacgacgagaga
ggcgggaggggcggccgcggcgggaggggcggccgcggcaggaagggcggccgccgcgcg
atgaaaaaacgcgggacgtcgcagcgcaagcgtacgaccgcgaccgtgcgtcgacgcatt
gcgaacagcgaggatcacgtctggattcagtactctccgtgcacgtgcgacggcccgtgc
gacgagcgcacctgtctctgcattcgcgacgggaacttttgcgagcgctactgcgcgtgc
ggcgggtcgtgctcgaacgcgttcaccggctgcgcgtgcctccgcgggcagtgccacacg
cgcgcttgcccgtgcttcgccgccgcgcgcgagtgcgacccggacctgtgcaagcgctgc
gtcgcgaccacggcgacgatcgcgcacgacgccagagaggggtggccgttcacggacctg
tgtctgccggtgccgccgccgccggaggtgccgacggagggaccgaacgcgcgcggggac
ccgacggagagctgcgtgaacatgaagctgctgctgcggcagcggaagcagatctgcttg
ggggtcagcgcgatcgcgggctggggcgcgttcctgaaggacggtgcgaagaagaacgag
ctcctcggcgagtacaccggcgagctcatcacgcaagtcgaggcggaccgccgagggaaa
atttacgaccgcgtgaactgctcgttcctcttcaacctgaacgaccagtggtgcttggac
gcgcacttgaaagggaacaagctcaagtttgcgaaccacagcgcgacgccgaactgctac
gcgaaggtgctcatggtgagaggcgaccaccgcgtcggcatattcgcgaaggataacatc
gcgccgggggaagagttgacgtacgattaccggtacgaacgcgataaagccccggcgtgg
gcgcagtcggacgagcccgcggggccgttggtgtattga

DBGET integrated database retrieval system