KEGG   Marinobacter psychrophilus: ABA45_09780
Entry
ABA45_09780       CDS       T03980                                 

Definition
(GenBank) stearoyl-CoA 9-desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
mpq  Marinobacter psychrophilus
Pathway
mpq01040  Biosynthesis of unsaturated fatty acids
mpq01100  Metabolic pathways
mpq01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mpq00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ABA45_09780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mpq01004]
    ABA45_09780
Enzymes [BR:mpq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ABA45_09780
Lipid biosynthesis proteins [BR:mpq01004]
 Desaturase
  First
   ABA45_09780
SSDB
Motif
Pfam: FA_desaturase DUF456
Other DBs
NCBI-ProteinID: AKO52660
UniProt: A0A0H4I4N4
LinkDB
Position
2177785..2178741
AA seq 318 aa
MTPVRHWLLNIVRWFDSDAGADNLDSDSRAFNLVRVIPFIALHLSCLLVYFTGTSTFAVM
FALAFFWIRMFAITGFYHRYFAHKTFKTSRTTQFIFGVLGASSAQRGPLWWAAHHRHHHQ
HSDQEQDLHSPQQGGFWWAHAGWFTCDAGFVMNERKVRDWLKFPELRFINRFDALVPAIA
ALMIYAVGEGLAAWAPGLGTNGFQLLVWGFFISTVVLFHATVSINSLSHVWGKRRFETGD
DSRNNFWLALLTLGEGWHNNHHRWPQSVRQGFRWYEIDITWYGLWLLARLGIIWDLNPIP
KSVQEETRKLDSIRRMQS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaccccagttcgacattggttactaaatatcgttcgatggtttgattccgacgcaggc
gcggacaacctcgacagtgattcacgggcgttcaacctagtccgcgttataccatttatt
gccctgcacctgtcatgcctcctagtatattttaccggcaccagcacttttgctgtgatg
tttgcactggcgtttttctggatacggatgtttgcgattactggattttatcaccgctat
tttgcccacaaaacgtttaaaacaagcagaactacccaatttattttcggggtcttaggc
gccagttctgcgcaacgcgggcccctttggtgggcggcacatcatcgtcatcatcaccag
cattcagaccaagagcaagacttgcactcgccccagcaaggcggtttttggtgggcacac
gcaggatggttcacgtgtgacgccggttttgttatgaacgaacggaaagtgcgcgattgg
ttgaaattccccgagttgcgctttattaataggttcgacgctttggtgccggccatcgcg
gcactgatgatttacgcagtaggtgaaggcttggcagcttgggcgcccgggctgggaacg
aatggcttccagttattagtttggggctttttcatctctactgtggtgctgtttcacgct
acggtgtccatcaactcgctgtcgcatgtgtggggcaagcgacgtttcgaaaccggagac
gacagccgcaataacttctggctggcattgcttactttgggtgagggttggcataacaac
caccatcgctggccgcagtctgttcgccaaggttttcgctggtacgaaatcgacattacc
tggtatggcctgtggttactggcccggttgggtattatttgggatctgaacccaattccg
aaaagcgttcaggaagaaactcgcaagttggattccattaggagaatgcagtcatga

DBGET integrated database retrieval system