KEGG   Marinobacter psychrophilus: ABA45_13685Help
Entry
ABA45_13685       CDS       T03980                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mpq  Marinobacter psychrophilus
Pathway
mpq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABA45_13685
Enzymes [BR:mpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ABA45_13685
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ABA45_13685
    1.1.1.-  
     ABA45_13685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AKO53340
UniProt: A0A0H4I6F3
LinkDB All DBs
Position
complement(3027968..3029026)
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDKGDIRIENIPEPTIEPGTVGIDVAWCGICGTDLHEFMEGPIFIPPCGHPHPV
SGESAPITMGHEFSGVVYAVGDGVDDIEIGQHVVVEPYIIADDVDTGPGQSYQLSKNMNF
IGLGGNGGGLSEKIAVKRRWVHPISAAIPLDQAALIEPLTVGYHAFVRSGAKAGDIALVG
GGGPIGLLLGAVLKAKGITVILTELSAKRKEKAKETGVADYVLDPSEVNVTEEVMKITKD
RGVDVSFECSSINEVLDTLVETTKPGGTVVIVSIWSHPATVNVHSVVMKELDVRGTIAYA
NNHAETIKLVEEGKVNLEPFITQRIKLDDLVAEGFERLIHNNESAVKIIVQT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctcgtttttatgacaaaggggatatccggattgaaaatatccccgaaccg
acgatagaacccggcactgtgggcatagatgtagcctggtgcggtatctgtggtaccgat
ttgcatgaatttatggaggggcccatctttattccgccgtgcggccacccccatccggtc
tcaggggaatctgcgccaataacaatggggcatgagttttcaggtgtggtttatgctgtt
ggtgacggtgtagacgatattgaaatcggtcagcacgttgtggttgaaccttatattatt
gcggatgatgtggacacgggtccgggtcagagttaccagttgtccaaaaacatgaacttt
attggccttggtggcaacggtggcggcttatccgaaaaaatcgcagtcaagcgtcgctgg
gtgcatccgatttccgccgccattcccctcgatcaagccgctttgattgaacctcttacg
gttggctatcatgcgtttgttcgcagtggcgctaaggccggtgatattgctctggttggc
ggtggcgggcctattggcctgttattgggggctgtgttaaaggctaagggtataaccgtt
atcctcacggagttgagcgcaaagcgtaaggaaaaagcgaaagagaccggcgttgcggat
tatgttttggatccctccgaagtcaacgtaaccgaagaggttatgaaaattaccaaagat
cggggtgtggatgtttcttttgagtgcagcagcatcaatgaagtgctggatacgctggta
gagacgacaaaaccgggcgggaccgttgttattgtatcgatttggagccacccagcgacg
gtgaatgtacacagcgttgtgatgaaagaactggacgtgcgtggaaccattgcttacgca
aacaaccatgcagaaaccattaagctggtagaggaaggcaaagttaatttggaacctttc
attacccaacgaattaaacttgatgatttggtggctgaaggtttcgagaggctgattcac
aacaatgagtcagccgtgaagatcattgttcagacataa

DBGET integrated database retrieval system