KEGG   Marinobacter psychrophilus: ABA45_14525Help
Entry
ABA45_14525       CDS       T03980                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mpq  Marinobacter psychrophilus
Pathway
mpq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mpq00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABA45_14525
Enzymes [BR:mpq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ABA45_14525
Transporters [BR:mpq02000]
 Other Transporters
  Pores ion channels [TC:1]
   ABA45_14525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AKO53483
UniProt: A0A0H4I6W0
LinkDB All DBs
Position
3200704..3201372
Genome map
AA seq 222 aa AA seqDB search
MITVHHLNNSRSQRILWLLEELGVPYEIQHYERDAKSMLAPDSLKKIHPLGKSPVITDGD
LVIAESGAIIEYLAHTYGKDTMLPKSGGQAWLDYTYWLHYAEGSLMPPLLMRLVFEKVKT
SPMPFFVKPVARGIANKTNEVFIGPMIKTHLDFIESHLAKNTWFLGDNLSAADIQMSFPL
EASVARGITGKNRPSIVTWVKRVHARPAYQNALEKGGEYDFA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattacggttcatcacctcaataactcccgctcacaacgcattctttggctgcttgaa
gagctgggagtgccctacgagatccagcactacgagcgtgatgccaaatccatgctggcg
cctgacagcctcaaaaaaatacacccgctgggtaagtcgccggtaatcaccgacggcgat
ttggttatcgcggagtccggcgccattatcgaataccttgcccacacttatggcaaagac
accatgctgccgaagagcggcggccaggcttggcttgattacacatactggctgcattac
gccgaaggctctttgatgccgccgctactgatgcgtttggtgtttgaaaaggtaaaaacc
agcccgatgccgttttttgtcaagccggtggcaagaggtattgcgaacaaaaccaacgag
gttttcatcggcccgatgatcaaaacgcacctcgattttatcgaatctcacctagcaaag
aatacctggtttcttggcgataacctgagcgctgcggatattcagatgagctttccgctg
gaagcctcagtggcccggggcatcaccggcaagaaccgacctagtatagtaacctgggtg
aagcgtgtgcacgccagaccggcttaccaaaacgctcttgaaaaaggcggggaatacgat
tttgcctga

DBGET integrated database retrieval system