KEGG   Marinobacter psychrophilus: ABA45_15195Help
Entry
ABA45_15195       CDS       T03980                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
mpq  Marinobacter psychrophilus
Pathway
mpq00061  Fatty acid biosynthesis
mpq01100  Metabolic pathways
mpq01212  Fatty acid metabolism
Module
mpq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mpq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ABA45_15195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mpq01004]
    ABA45_15195
Enzymes [BR:mpq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ABA45_15195
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     ABA45_15195
Lipid biosynthesis proteins [BR:mpq01004]
 Fatty acid synthase
  Component type
   ABA45_15195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AKO53603
UniProt: A0A0H4I762
LinkDB All DBs
Position
3346267..3346791
Genome map
AA seq 174 aa AA seqDB search
MDSNPYPNTFSKQDLIDCGHGELFKGAGMRLPIDEMLMFDRITHIGNEGGLYGKGGLTAE
LDINPDLWFFKVHFDSDPVMPGCLGLDAMWQLLGFYLAWTGGKGKGRALGSGQVKFFGQV
LPNAKKVTYHLDFKRLIKRKLTMAIADGRMEVDGKEIYTAKDLRVGLFTSTDNF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggattccaacccgtaccccaacacgtttagcaaacaagacctgatcgactgcggtcac
ggtgaattgttcaagggcgctggcatgcgcctgcccattgatgaaatgctgatgttcgac
cgcatcacccacattgggaacgaaggtgggctttacggcaaaggcggcctgaccgcagag
ctggatatcaacccggacctgtggttcttcaaggtgcactttgacagcgatcccgttatg
ccgggttgcctgggccttgacgccatgtggcagctgctcggtttctacctggcatggacc
ggtggcaagggcaaaggccgcgcgctgggctcgggtcaagtgaaattctttggccaggtt
cttcctaatgccaaaaaagtcacttaccatcttgacttcaaacgtcttataaagcgtaag
ttaaccatggctatcgctgatggccgcatggaagtggacggcaaggaaatttatacggcc
aaagacctacgtgtaggcctgttcacttccaccgacaatttttag

DBGET integrated database retrieval system