KEGG   Marinobacter psychrophilus: ABA45_17020
Entry
ABA45_17020       CDS       T03980                                 

Definition
(GenBank) LOG family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
mpq  Marinobacter psychrophilus
Pathway
mpq00230  Purine metabolism
mpq00240  Pyrimidine metabolism
mpq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ABA45_17020
   00240 Pyrimidine metabolism
    ABA45_17020
Enzymes [BR:mpq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     ABA45_17020
    3.2.2.-  
     ABA45_17020
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AKO53926
UniProt: A0A0H4I4C3
LinkDB
Position
3751869..3753248
AA seq 459 aa
MNEPTINALVSPEGSLEILSNHEVNRLKDRSEGGLYRLFRQCALAVLNTGVVTDDCQDLM
SAHSDFEVHLVPQPRGLKLELINAPHHAFVDNEMLRANREHLFSVLRDIVYTHSSPLFIE
ANRHPQPEDLTNMVFHILRNARVLKPGRQPDMVVCWGGHSISHEEYQYSKEVGHQLGLRE
LSICTGCGPGAMKGPMKGATIGHAKQRVKDGRYIGITEPGIIGAEAPNPIVNELVIMPDI
EKRLEAFVRLGHGVIVFPGGVGTAEEILYLLGILLHPDNADIPFPVVFTGRRENADYFEM
IDKFIRNALGDDAAKRYEIIIDDPVRVARTMKLGMQEVETFRRAMQDAYYFNWTLKIDPV
FQLPFEPDHANMRALELHRDQPVHLIAANLRKAFSGIVAGNVKEEGIQKVRAHGPFEIAG
DPSLIKPLEAMLEQFVAQNRMKLPGTSAYRPSYRIISKA
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaatgaacccaccatcaacgcgttggtgtcgcccgaaggcagcctcgaaatcctgtct
aaccatgaagtaaaccgcctgaaagaccgcagtgaaggcggcctttaccggctgttccgc
caatgcgcactggcagtactgaataccggcgtggttaccgacgattgccaggatttgatg
tcggcccacagcgactttgaggtgcacctggtaccccagccccgcggcctgaaactggaa
ctgatcaacgcaccccaccatgcctttgtcgacaatgaaatgctgcgcgccaatcgcgaa
catttgttttcggtgttgcgcgacatcgtatacacccattccagcccgctgttcattgaa
gccaaccggcatccgcagccggaagatctgaccaacatggtgtttcacattctgcgcaac
gcgcgcgtgctgaaaccggggcgacagccagacatggtggtgtgttggggtggccattcc
atcagccatgaagaataccaatacagcaaagaagtgggccaccagttgggtctgcgtgaa
ctgagcatttgcaccggctgcggccccggcgccatgaagggccctatgaaaggcgccacc
ataggccacgccaagcagcgggtaaaagacggtcgctacattggcattaccgaacccggc
attatcggcgccgaggcacccaatccgattgtgaacgaactggtgatcatgccggatata
gaaaaacgcctggaagccttcgtgcgccttggccacggcgtgattgtattccccggtggt
gtgggcacagcagaagaaattctttacctcttgggtattctgttgcacccagacaacgcc
gatattcccttcccggtggtgtttaccggcaggcgcgagaacgctgattattttgaaatg
atcgacaagttcatccgcaacgccttgggtgacgacgccgcaaagcgctatgaaatcatc
atcgacgatccggtgcgggtagcgcgcaccatgaaactcgggatgcaagaggtcgaaacc
ttccgccgcgccatgcaagacgcctattactttaattggacgttaaaaatagaccctgtg
tttcagctgccatttgagccggaccacgccaacatgcgcgccttggaactgcatcgcgat
cagccagtgcacttgattgcggcaaatctgcgcaaagccttcagcggtattgttgcgggt
aacgtaaaggaagaaggaattcaaaaggtgcgcgcacatggcccgttcgaaattgcgggc
gaccccagcctgattaagcctttggaagccatgctggaacagtttgtggctcaaaaccgg
atgaaactacccggcacctcggcttatcggccaagctaccggattattagcaaggcatag

DBGET integrated database retrieval system