KEGG   Marinobacter psychrophilus: ABA45_17450Help
Entry
ABA45_17450       CDS       T03980                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mpq  Marinobacter psychrophilus
Brite
KEGG Orthology (KO) [BR:mpq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABA45_17450
Enzymes [BR:mpq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ABA45_17450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored DAO HI0933_like Glutaredoxin K_oxygenase FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-ProteinID: AKO54002
UniProt: A0A0H4IGF1
LinkDB All DBs
Position
complement(3847448..3849016)
Genome map
AA seq 522 aa AA seqDB search
MLDAKLKDQLKGYLDNVKQPIELAAALDDSAKASELYELLQEIDALSDMITLREDGDSDV
RRPSFAINRVGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKATPELIQQVQELDGNFE
FETYFSLSCQNCPDVVQALNLMSVLNPSVKHTAIDGALFQAEVEEREIMAVPSVYLNGKL
FGQGRMKLEEIVAKLDTNTDAREADKIRQKGIFEVLVIGGGPAGSAAAVYAARKGITTGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQNVIEYGVEIMNMQRAEKLIPATKPG
MPHEIRMANGASLKARTLVLSTGARWRQLGVPGEDKYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLLEFGAELRADEVLQRKLRSLKNVDVAVSAQTTEVTGA
NGKVNGLDYTDRNSGKNVHVELEGVFIQIGLLPNTEWLKGDIELSKHGEVVINERNETSI
PGVFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSADE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgccaagctgaaagaccagttgaaaggttacttggacaatgtaaaacagccc
attgagctggctgcggcgctggacgacagtgccaaagctagcgagctgtatgagctgctg
caggaaatcgacgcgttgtctgacatgattactctgcgtgaagatggcgactctgacgtg
cgtcgcccgtcatttgctattaaccgtgttggtactgacataggtgtgcgctttgccggt
atccctatgggccacgagtttacgtcactggttttggcattgttgcaggtgggtggacac
ccttccaaggccactcccgagttaatccagcaggtacaggaactggacggcaattttgaa
tttgaaacttacttttcgctgtcatgccagaactgtccggatgtggtgcaggcgctgaac
ttgatgagtgtgctgaacccaagcgtgaagcacaccgccattgacggcgccttgttccag
gccgaggtggaagagcgtgaaatcatggcggtgcccagcgtgtacctgaacggcaagctg
tttggccagggccgtatgaagctggaagaaattgtagccaagctggacaccaacaccgac
gcccgtgaagctgataaaattcgccagaagggcatctttgaagtgttggtaatcggcggt
ggccccgcaggctccgcagcggctgtttacgcggcccgtaaaggcatcaccaccggcatt
gccgctgaacgttttggtggtcaggttgctgacactatgggcattgaaaacctgatttcc
gtgccctacacagaaggccccaagctagtggccgcgatggagcagaacgtcatagagtat
ggtgtggagatcatgaacatgcagcgggccgaaaagctgattccagcgacaaagccgggc
atgcctcatgaaattcgtatggccaacggtgcctcgttgaaagcccgcaccttggtgttg
tctaccggtgcccgttggcgccagctgggtgttcccggtgaggacaagtaccgcaacaag
ggcgtggcttactgcccgcactgcgacggcccattgttcaaaggcaagcgcgtagccgtc
attggcggcggtaactcaggcgtggaagccgccatcgacctggccggtattgttggccac
gtaaccttgctggaatttggtgccgaattgcgcgctgacgaagtgctgcagcgtaagctg
cgcagcctgaagaacgtggatgtcgcggtatcggcccagaccactgaagtgaccggtgcc
aacggcaaggtaaatggcctggactacacggatcgcaacagcggtaaaaatgttcacgta
gagctggaaggcgtgttcatacaaatcggcctgttacccaacaccgagtggctgaaaggc
gatatcgaactcagcaagcacggtgaagtagtcatcaacgagcgcaacgagaccagtatt
cctggcgtatttgccgccggtgatgctaccactgtgccctacaagcagattgtgatttcc
atgggtgaaggttccaaagcggccctgagtgcctttgacttcctgattcgcaactctgct
gacgaatag

DBGET integrated database retrieval system