KEGG   Marinobacter psychrophilus: ABA45_17615
Entry
ABA45_17615       CDS       T03980                                 

Definition
(GenBank) sugar phosphorylase
  KO
K23079  glucosylglycerol phosphorylase (configuration-retaining) [EC:2.4.1.359]
Organism
mpq  Marinobacter psychrophilus
Brite
KEGG Orthology (KO) [BR:mpq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABA45_17615
Enzymes [BR:mpq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.359  glucosylglycerol phosphorylase (configuration-retaining)
     ABA45_17615
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AKO54030
UniProt: A0A0H4I8H1
LinkDB
Position
3882725..3884167
AA seq 480 aa
MLLKNAVQLICYPNRIGNNLKDLYTVVDKHLSEAIGGLHILPFFPSNADGGFSPLTHKEV
DPDFGTWDDIEAFTKKYDLCVDLTVNHISDESPEFKDFIAHGFDSKYADLFVHVDKFGEI
SPDDMAKIHIRKEKEPFREVTLADGTKTRVWCTFTEQQIDLNYESDQAYRLMESYIGFLT
SKGVNLLRLDAFGYTTKRIGTSCFLVEPEVYRILDWINEVALKHGAECLPEVHDHTSYQY
AIGRRNMHPYGFALPPLLLYSLLDANSVYLKNWLRMCPRNMVTVLDTHDGICIPDVEGVL
PDEKIRALIDNIDARSADPIMRRSAANIHSVGAIYQLTCTFYDALMQNDDAYIAARAIQF
FTPGIPQVYYVGLLAGCNNHELMKQSGELRDINRHYYTLDDVEQHIQKPVVQRLLALMTF
RSNYPAFDGHFELNYSNNSSVAMAWRHGDYYCHLFVDLNFNTVKIGYYDLDTAQMEKLAC
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgctgttaaaaaatgccgtgcagctgatttgctacccaaaccgaattggcaataacctg
aaagacctctatacggtggtcgacaaacacctgtcagaggccattggtgggctgcatatc
ttgccgttttttccgtccaatgccgatggcgggttttcgcccttgactcacaaggaagtg
gatccggactttggtacctgggacgacattgaagccttcacgaaaaagtacgacctgtgt
gtcgacctgacggtgaaccatatctctgacgagtctcccgagtttaaggattttatcgcc
catggcttcgattcgaagtatgccgacctgttcgttcatgtcgacaagttcggcgagatt
tctccggatgacatggccaagattcatatccgcaaagagaaagaacccttccgggaagtg
acgcttgcggatggcacaaaaacccgggtctggtgcaccttcaccgagcagcagattgac
cttaattacgagtccgaccaggcttaccgcctgatggaaagttatatcggctttctcacc
tcgaaaggtgtaaacctgctgaggctcgatgcctttggttacaccaccaaacgtatcgga
accagctgctttttggtggagcccgaagtttatcggatactcgactggattaacgaagtg
gccctgaaacacggcgcggaatgcctgccggaagtccacgatcacaccagttatcaatac
gcgatcggccgacgcaacatgcacccctacggctttgctctgccgccccttttgctctac
tcgctgctggacgcaaacagcgtatacctgaaaaactggctgcgaatgtgcccacgcaac
atggtgaccgtattagatacccacgacggaatctgtattccggatgtcgaaggggtgttg
ccggatgaaaaaattcgagcgcttattgataacattgatgcccgcagtgcagacccgatc
atgcggcgctcagcggccaatatccacagcgttggtgcaatctaccagctcacctgcacc
ttctatgacgcgctcatgcagaacgatgacgcctacattgccgctcgggcgattcagttt
ttcacacccggcattccgcaggtctactacgtggggttgttggctggatgcaacaaccac
gaactgatgaaacaaagcggcgaactgcgggatatcaatcgccattactacaccctggac
gacgtggaacaacacattcagaagcccgtcgtgcaacgcttactggccctgatgacgttt
cgtagtaactaccctgcttttgatggccattttgaactcaactactccaacaattccagc
gtggccatggcctggcgccatggagactattactgccatctgtttgtcgacctaaacttt
aataccgtaaaaatcgggtattacgacctcgacaccgcacaaatggaaaaacttgcgtgt
taa

DBGET integrated database retrieval system