KEGG   Moniliophthora perniciosa: MPER_09178Help
Entry
MPER_09178        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00052  Galactose metabolism
mpr00500  Starch and sucrose metabolism
mpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MPER_09178
   00500 Starch and sucrose metabolism
    MPER_09178
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MPER_09178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-ProteinID: EEB92330
UniProt: E2LQH1
LinkDB All DBs
AA seq 363 aa AA seqDB search
MSPARFGFTKNVANLCLYLVKGSNPCSLLDIPIVNAAIAKQANNTDFYDVYTRGAELDVF
VKNPDGSEHIGIVWPGYTVFPDWLAPATQAWWTEALKNWSDFGVEYSGIWLDMNEIASFC
DGSCGTGQDIGALQVPPLVLPGSPGNIVTDYPECYDPERFGPSGNITVNGTLTCQPDNSI
AKRGLGAGGQSNINVVSPPYAIHNGNGPLSDRTLATNATHIGGVLDLDIHNMFGMMEEKA
THLALQQLQPGNRPFLISRSTFPSSGKWTGHWLGDNFSKWQYLYLNIQGVLQFQLFQIPF
VGADACGFNGNTDEELCNRWMQLSAFTRFIEITCFRRNSQEPGGGIACYASERHRTHIHV
PTG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgccaggtttggattcaccaaaaatgtagcaaatttatgcctataccttgtg
aaaggttctaacccatgctctctcctagatattcccatcgtgaatgcggccattgcgaaa
caagcaaataacactgatttttatgacgtatatactcgaggagctgaactcgacgtcttt
gtaaaaaatcccgacggttctgagcatattggaatagtatggcctgggtacactgtgttt
cctgattggcttgcgccagccactcaggcttggtggaccgaggcactcaagaattggagt
gatttcggcgtggaatactctgggatatggctcgatatgaacgaaattgcgtcattctgt
gacggctcctgcggcacaggtcaagatatcggcgcccttcaagtacctcctcttgttcta
cccggtagccctggaaacatagtcaccgactatccagagtgctatgatccagaacgattc
gggccaagtggaaacattacagtcaacggaaccttgacgtgccaacctgataactcgatt
gcaaaacgtggactcggcgctggtggtcagagcaacattaacgttgtttccccgccttat
gctatacataatggcaatggtcctttgtctgacaggacactcgctacaaatgccacccac
ataggcggagtacttgacctcgatattcataacatgtttggaatgatggaggaaaaagcc
acccacttggctctacaacaactccaaccaggaaaccgtcctttcctcatatcgcgatct
actttcccatcatccggaaaatggacaggccactggcttggggacaacttctcaaaatgg
cagtacttgtatctcaatatccaaggtgttttgcaattccaactcttccagattccattt
gtcggtgcagacgcatgcggattcaatggcaatacggacgaagagctgtgcaaccgatgg
atgcagttgtctgcgttcacccgttttatcgaaatcacatgttttaggcgcaattcgcaa
gagcctggaggtgggatagcgtgctacgcatcagaacggcatcgcacgcatattcatgta
ccgactgggtag

DBGET integrated database retrieval system