KEGG   Moniliophthora perniciosa: MPER_10570Help
Entry
MPER_10570        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00250  Alanine, aspartate and glutamate metabolism
mpr00410  beta-Alanine metabolism
mpr00430  Taurine and hypotaurine metabolism
mpr00650  Butanoate metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MPER_10570
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MPER_10570
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MPER_10570
   00430 Taurine and hypotaurine metabolism
    MPER_10570
Enzymes [BR:mpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MPER_10570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: EEB91124
UniProt: E2LTX7
LinkDB All DBs
AA seq 566 aa AA seqDB search
MALSKHINPDRLLQDSHDKKTKHHVLTKTDPNQIQHTYGARYGTNPIPKYHLPSKGIEAD
SAYQLIHDELALDGSPVLNLASFVHTWMPPQADKLMQENMSKNLIDCDEYPATQILHTRC
ISMLAHLWNAPHAKNAVGTATTGSSEAIQLGGLAMKRIWQEKRKAAGKSIHEPGPNIVMG
ANAQVALEKFARYFDVECRLVPISVESKYRLDPKKAMQYVDENTIGVALNPPRHVHWPLR
AREENDRPLSEYKKNMGFSVLIHVDAASGGFVAPFATVSFPDSRVPVVSINTSGHKFGLA
YVGVGWVIWRDKAHLPKDLIFELHYLGSVEYSFSLNFSRPAAPIIAQYFNLIHLGFEGYR
NVALNDLRNARLLSRALEGSEYYTVLSDIHRQPSGAPTKGSGKTEVAEVRYFDYLFTLPN
LMSWAELRTWFTSCILPILRRLQAKVPGHPAEVDSDALACQRMASSAGHYSSKSSDDHNR
IVPNYELAPDLESIEILRVVVRENMSEVLIDRLVADLIEITEQLTKSDSSIHALNNLGTT
HSSRPEAVHGRMDEGSKPSGTYAKQC
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggctctctccaagcacatcaatccagatcgtctgttacaggactcccatgacaagaag
acaaaacatcatgttctaaccaagaccgatccaaaccagatacaacacacatatggcgca
cgctacggaaccaatcccatccccaaataccaccttccatccaagggaatcgaggcagac
tcggcatatcaacttattcatgacgaactcgcccttgatggttccccagttctcaacctt
gcgtccttcgttcatacgtggatgcctcctcaggcggacaaactcatgcaagagaacatg
tccaaaaacctgatagactgtgatgaatatccagccactcaaatcttgcatacacgttgt
atctcaatgcttgcacacctttggaatgctccacacgccaaaaatgccgttggcaccgca
actactggttcatcggaagccatccagctgggcggcttggccatgaaacgcatttggcaa
gagaaacggaaggcggcaggaaaaagtattcatgaacctggacccaacatcgtcatggga
gctaatgcccaagttgctcttgaaaagtttgctcgatacttcgacgtggaatgccgtctg
gtccccatttctgtcgaaagcaagtaccgccttgaccccaagaaagcaatgcagtatgtg
gacgagaataccattggagtggcgttgaacccaccaaggcacgtacactggccactacga
gcccgtgaagaaaatgacagacctttgtccgaatacaaaaaaaacatgggattctcagtc
ctaatccatgtcgatgcagcttccggtggcttcgtagccccattcgccacggtcagtttt
ccggactcacgagttccggtcgtttctattaatacttcagggcataaattcggtctagca
tacgttggagttggttgggtgatctggcgcgacaaagctcaccttcccaaagacctcatc
tttgaactccattatctcggttcggtggaatattccttttcgctcaacttttctcggcct
gcggcgccgatcattgcccagtatttcaatctgatccatttaggattcgagggttatagg
aatgttgcgctaaatgatctgaggaatgcgaggctactcagcagggctcttgaaggaagc
gagtattatacggttttgagtgatatccaccggcagccttcaggagcccccacgaagggc
tcggggaaaacggaagttgcagaagtgagatattttgactaccttttcacgcttccaaat
ttgatgtcttgggcagaattacgaacctggtttaccagttgtatccttccgattctcaga
cgacttcaagcaaaagtacccggacatccagcagaagtggattcagacgctcttgcgtgc
caaaggatggcaagttctgctggtcactactcttccaagtcttctgatgatcataacagg
attgtgcccaactatgagctggctcccgaccttgaaagcatcgaaatcctccgagtcgtc
gttcgtgagaatatgtcggaagtgctcatcgaccgtctagttgcggacctaatcgagatc
accgaacaactgacgaagagtgactcgtccatccacgcgttgaataatttgggtactacc
cattcgtctcggcctgaagcagttcatgggaggatggatgagggtagcaaaccttcggga
acgtatgccaagcaatgctga

DBGET integrated database retrieval system