KEGG   Moniliophthora perniciosa: MPER_11995Help
Entry
MPER_11995        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00020  Citrate cycle (TCA cycle)
mpr00190  Oxidative phosphorylation
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
mpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MPER_11995
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MPER_11995
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MPER_11995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: EEB89864
UniProt: E2LXI7
LinkDB All DBs
AA seq 315 aa AA seqDB search
VLGELACEPLRVAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWKWHMYDTVK
GSDWLGDQDAIHYMCREAPSTVIELEHFGVPFSRTKDGKIYQRAFGGQSLKYGKGGQAYR
CAAAADRTGHAILHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFR
AHKTVLATGGYGRAYFSCTSAHTCSGDGNAMVVRAGLPLQDLEFVQFHPTGIYGAGCLIT
EGSRGEGGYLLNSEGERFMERYAPTAKDLASRDAVSRSMTIEIPEGRGVGPKGDPLSHLQ
HAAWTGAFSPLTGKP
NT seq 947 nt NT seq  +upstreamnt  +downstreamnt
aggtgctgggggagctggcttgcgagccgcttcgggtggcggaagctggtttcaatacag
cttgcataacgaaattgttcccgacaagaagccatacggttgctgctcagggtgggatca
atgctgcgttaggaaacatgaccgaggacgactggaaatggcatatgtatgatacggtta
agggatctgactggctcggtgaccaggacgcaatacactatatgtgccgggaggctccca
gtactgtgattgagcttgagcatttcggcgtaccgttctcccggacaaaggacggcaaaa
tctatcaaagagccttcggtggacagtctttgaagtacggcaagggtggtcaagcctatc
gatgtgctgcagctgctgatcgtactggccacgccattctgcacacattatacggacaat
ctctgcgacacaacaccaacttctttatcgaatactttgctctcgacctgattatgcaag
atggcgaatgtgtcggagtcattgctctgaacatggaagatggtacactccataggttcc
gtgcacataagactgtactcgccactggtggttatgggcgagcatacttcagttgcacca
gtgcacacacatgctcaggagacggaaacgccatggtcgttcgcgcaggtcttcccctgc
aagatttagagttcgtgcagttccatccgacaggtatttatggtgcaggatgtctcataa
cagaaggttctcgtggtgaaggaggctacctcttgaactcagagggcgagcgattcatgg
agcgttatgctcctaccgccaaggatctagcttctcgtgacgctgtttctcgaagtatga
ccattgaaatccccgaagggcgtggtgtgggccccaaaggggatcctctaagtcacctgc
agcatgcagcttggactggcgccttttcacctctgacgggaaaacct

DBGET integrated database retrieval system