KEGG   Moniliophthora perniciosa: MPER_13031Help
Entry
MPER_13031        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
mpr  Moniliophthora perniciosa
Brite
KEGG Orthology (KO) [BR:mpr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpr01001]
    MPER_13031
Enzymes [BR:mpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MPER_13031
Protein kinases [BR:mpr01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   MPER_13031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Haspin_kinase Kinase-like APH Kdo
Motif
Other DBs
NCBI-ProteinID: EEB88938
UniProt: E2M064
LinkDB All DBs
AA seq 437 aa AA seqDB search
MKFLIDAMGGDLSNPVWNYRANFDVSRTSNISVSAYLRTAAVQGPDDMGNDLLLSRVDLT
PMLEGHHATDQWYNATGGSGSFHLKIDFKPTRNEPLTIEAFDLLKVIGKGSFGKVMQVRK
KDTQRIYALKKIRKAHIAQRPGEITHILAERTVLALVNNPFIVPLKFSFQNPDKLYLVMS
FVNGGELFYHLQREGKFDQDRSRFYAAELLLALEHLHGFNVVYRDLKPENILLDYTGHIA
LCDFGLCKLNMSETEKTNTFCGTPEYIAPELLESQGYTKTVDWWTLGVLLYEMMTGLPPF
YDENVNTMYQRILTDPLNFPSDMSPEAKSVMTGLLQRDPAKRLGTKGGEEIQKHPFFANH
IDWRRLLAKGYTPPFKPAVESVLDVANFDPDFTNEEAQDSVVLDSHLSQTVQDQFHGFTY
NPANEHLSESVSYPNAL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttgattgatgctatgggcggagatctcagcaatcctgtctggaactacagg
gccaatttcgatgtgtcgcgtacttccaacatctcagtatcagcctatctcaggacagcg
gccgttcaaggtccagatgatatgggaaatgatctcttgttatctcgagtagatttaacc
ccaatgcttgaaggccaccacgccactgatcaatggtacaacgccaccggcggctctggc
tcatttcacctcaaaatcgacttcaagcccacccggaacgaaccccttaccatcgaagcc
ttcgatctcctcaaggtgatcggcaaaggcagctttggcaaagtcatgcaggtccgcaag
aaggatacgcagcgtatctatgctctcaagaagattcgtaaagctcatattgcccaacga
cctggggagattactcacatcctggctgagcgaactgtcttggctcttgtcaacaacccc
ttcattgtacccctcaagttctccttccagaatcccgataaactgtacctggtcatgtca
tttgtgaacggtggagaactgttctatcatctgcagagagagggcaaatttgatcaagat
cgcagtcgtttttatgccgctgaacttttacttgctctggagcacctacacgggttcaac
gtcgtttatcgcgaccttaagcctgaaaacattctactggattacacgggccatatcgct
ctgtgtgatttcggtctatgtaaactcaacatgtccgaaacggagaaaactaatacgttc
tgtggtactccggaatatattgcccccgagcttctggagagtcaaggctataccaagacc
gtcgactggtggactcttggtgtcttattgtacgagatgatgaccggccttccaccgttt
tacgacgaaaacgtcaacaccatgtatcaacgcattctcaccgacccgctcaactttccc
tccgatatgtctcctgaagccaagagtgtcatgactggattgttgcagcgtgatcctgcc
aaacgattgggaactaagggcggcgaagagattcagaaacatcctttctttgcgaatcac
attgactggcggaggttattagccaagggctatacaccaccgttcaaacccgccgttgaa
tccgtactggacgtcgccaactttgaccccgatttcaccaatgaagaggcacaagattct
gtcgtactcgattctcacctgtcgcaaaccgttcaggaccaattccatggtttcacgtat
aacccggccaacgaacatctcagcgagagcgttagctatcccaatgcgctttga

DBGET integrated database retrieval system