KEGG   Moniliophthora perniciosa: MPER_15460Help
Entry
MPER_15460        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00500  Starch and sucrose metabolism
mpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPER_15460
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MPER_15460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: EEB87267
UniProt: E2M4Y4
LinkDB All DBs
AA seq 105 aa AA seqDB search
RIQQISKASGTITTGGLGEPKFNINETAFTGSWGRPQRDGPPLRAIALITWANYLVANNN
RSYVTNTLWPIIQRDLDYTAQNWNQTKYYTNPALWRTDELTGIYV
NT seq 320 nt NT seq  +upstreamnt  +downstreamnt
ctcgcatccaacaaatctcgaaggcctcgggcaccattactaccggcggattgggtgagc
caaagttcaatattaatgaaacagctttcaccggttcctggggtcgtccccaacgagatg
gtcctcctcttcgtgcaattgcgctcatcacctgggccaactacctagtcgcgaataaca
acagatcctatgtcaccaacacgctctggcccatcattcaacgcgatcttgactacaccg
ctcaaaattggaatcagacgaagtactacacaaatccagccttatggaggacggatgaac
taaccggaatatacgtatag

DBGET integrated database retrieval system