KEGG   Moorea producens: BJP34_05370
Entry
BJP34_05370       CDS       T04499                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpro  Moorea producens
Pathway
mpro00010  Glycolysis / Gluconeogenesis
mpro00020  Citrate cycle (TCA cycle)
mpro00620  Pyruvate metabolism
mpro01100  Metabolic pathways
mpro01110  Biosynthesis of secondary metabolites
mpro01120  Microbial metabolism in diverse environments
mpro01200  Carbon metabolism
Module
mpro_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJP34_05370
   00020 Citrate cycle (TCA cycle)
    BJP34_05370
   00620 Pyruvate metabolism
    BJP34_05370
Enzymes [BR:mpro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BJP34_05370
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Aminotran_1_2 MadL PASTA
Other DBs
NCBI-ProteinID: AOW98954
UniProt: A0A1D8TMW8
LinkDB
Position
complement(1404765..1406075)
AA seq 436 aa
MIHEVFMPALSSTMTEGKIVSWEKSPGDKVEKGETVVVVESDKADMDVESFYEGYLATIT
VSAGDSAPVGAPIALIAETEAEIEAAKQQAAQSTPATDTATPQQATASTPEPVQTALAAV
ADTPSRRNGRIIASPRARKLAKELRVDLNTLRGSGPHGRIVAEDVEAAAGKGSTPPAPAT
TTPAPLPTAAVMPTPTPATMPAPLPAPPAAVPLGEVVPFNTLQNAVVRNMMVSLQVPTFR
VGYTITTDELDKLYKKIKPKGVTMTGLLAKAVAVTLQKHPLVNASYTERGIQYHSSINVA
VAVAMADGGLITPVLRHAEQLDIYSLSRTWKDLVDRARTKQLQPEEYNSGTFTLSNLGMF
GVDRFDAILPPGQGSILAIGASRPTVVATPDGMMGVKRQMQVNITCDHRIIYGTDAAAFL
QDLAKLIETDPQSLTL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgattcacgaagttttcatgcccgccctcagttcaaccatgaccgaaggcaaaatcgtt
tcctgggaaaaatctccgggagacaaagtcgaaaaaggtgaaaccgtggtggtggttgag
tccgataaagctgatatggacgttgagtccttctatgaaggctatcttgccacaatcacg
gtatcagctggtgactctgctccggtgggagccccgattgctctgattgcggaaacggaa
gcggaaattgaggcagctaaacaacaagctgcccaatctacaccagctactgacacagca
acgcctcagcaagcaacggcctcaaccccagaaccggtacagacagctcttgctgcagtt
gctgatactcccagccgccgtaatggccgaattattgcttctccccgggctcgtaaacta
gcgaaggaattacgggttgatctcaataccttgagaggaagtggtccccatggcaggatt
gtggctgaggatgtggaagcagcagcaggtaaagggagtactcccccggcaccagcaacc
accaccccagcaccactgccgacagcggctgtaatgcccactcccaccccagcaactatg
ccagcacctctgccagcacctcctgcagctgtacccctgggagaagtggtgccgttcaat
accctccaaaatgcagtggtgcggaatatgatggtcagcctgcaagtgcctaccttcagg
gttggttacaccatcactaccgatgagttagataagttatacaaaaaaatcaagcctaag
ggtgttaccatgaccgggctgctcgctaaggcagtagcggttaccttgcagaagcatccc
ctggtcaatgctagttataccgaacggggaattcaatatcacagttccattaatgtagct
gtggctgtggcaatggctgatggtggcttgattaccccagtattgcgccatgcggagcag
ctggatatttattctctgtctcgcacttggaaagatttagtagaccgtgccagaactaag
cagttgcagccagaggaatataactcgggtactttcaccctatccaatttaggaatgttt
ggtgtagaccggtttgatgcgattttgcccccaggacagggttctattttggccattggt
gcatcccgtcctacggtagtggctacccctgacggcatgatgggtgtaaagcgtcagatg
caagtgaatattacctgtgaccaccggattatctatggtactgatgctgcagcgttcttg
caagacttggcgaagttgattgaaactgatccgcaatcgttaactctttaa

DBGET integrated database retrieval system