KEGG   Moorea producens: BJP34_05370Help
Entry
BJP34_05370       CDS       T04499                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpro  Moorea producens
Pathway
mpro00010  Glycolysis / Gluconeogenesis
mpro00020  Citrate cycle (TCA cycle)
mpro00620  Pyruvate metabolism
mpro01100  Metabolic pathways
mpro01110  Biosynthesis of secondary metabolites
mpro01120  Microbial metabolism in diverse environments
mpro01130  Biosynthesis of antibiotics
mpro01200  Carbon metabolism
Module
mpro_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJP34_05370
   00020 Citrate cycle (TCA cycle)
    BJP34_05370
   00620 Pyruvate metabolism
    BJP34_05370
Enzymes [BR:mpro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BJP34_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Aminotran_1_2 MadL PASTA DUF1586
Motif
Other DBs
NCBI-ProteinID: AOW98954
UniProt: A0A1D8TMW8
LinkDB All DBs
Position
complement(1404765..1406075)
Genome map
AA seq 436 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVSWEKSPGDKVEKGETVVVVESDKADMDVESFYEGYLATIT
VSAGDSAPVGAPIALIAETEAEIEAAKQQAAQSTPATDTATPQQATASTPEPVQTALAAV
ADTPSRRNGRIIASPRARKLAKELRVDLNTLRGSGPHGRIVAEDVEAAAGKGSTPPAPAT
TTPAPLPTAAVMPTPTPATMPAPLPAPPAAVPLGEVVPFNTLQNAVVRNMMVSLQVPTFR
VGYTITTDELDKLYKKIKPKGVTMTGLLAKAVAVTLQKHPLVNASYTERGIQYHSSINVA
VAVAMADGGLITPVLRHAEQLDIYSLSRTWKDLVDRARTKQLQPEEYNSGTFTLSNLGMF
GVDRFDAILPPGQGSILAIGASRPTVVATPDGMMGVKRQMQVNITCDHRIIYGTDAAAFL
QDLAKLIETDPQSLTL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgaagttttcatgcccgccctcagttcaaccatgaccgaaggcaaaatcgtt
tcctgggaaaaatctccgggagacaaagtcgaaaaaggtgaaaccgtggtggtggttgag
tccgataaagctgatatggacgttgagtccttctatgaaggctatcttgccacaatcacg
gtatcagctggtgactctgctccggtgggagccccgattgctctgattgcggaaacggaa
gcggaaattgaggcagctaaacaacaagctgcccaatctacaccagctactgacacagca
acgcctcagcaagcaacggcctcaaccccagaaccggtacagacagctcttgctgcagtt
gctgatactcccagccgccgtaatggccgaattattgcttctccccgggctcgtaaacta
gcgaaggaattacgggttgatctcaataccttgagaggaagtggtccccatggcaggatt
gtggctgaggatgtggaagcagcagcaggtaaagggagtactcccccggcaccagcaacc
accaccccagcaccactgccgacagcggctgtaatgcccactcccaccccagcaactatg
ccagcacctctgccagcacctcctgcagctgtacccctgggagaagtggtgccgttcaat
accctccaaaatgcagtggtgcggaatatgatggtcagcctgcaagtgcctaccttcagg
gttggttacaccatcactaccgatgagttagataagttatacaaaaaaatcaagcctaag
ggtgttaccatgaccgggctgctcgctaaggcagtagcggttaccttgcagaagcatccc
ctggtcaatgctagttataccgaacggggaattcaatatcacagttccattaatgtagct
gtggctgtggcaatggctgatggtggcttgattaccccagtattgcgccatgcggagcag
ctggatatttattctctgtctcgcacttggaaagatttagtagaccgtgccagaactaag
cagttgcagccagaggaatataactcgggtactttcaccctatccaatttaggaatgttt
ggtgtagaccggtttgatgcgattttgcccccaggacagggttctattttggccattggt
gcatcccgtcctacggtagtggctacccctgacggcatgatgggtgtaaagcgtcagatg
caagtgaatattacctgtgaccaccggattatctatggtactgatgctgcagcgttcttg
caagacttggcgaagttgattgaaactgatccgcaatcgttaactctttaa

DBGET integrated database retrieval system