KEGG   Moorea producens: BJP34_12095Help
Entry
BJP34_12095       CDS       T04499                                 

Definition
(GenBank) GTPase
Organism
mpro  Moorea producens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COR LRR_8 LRR_4 Roc Ras Arf LRR_5 Gtr1_RagA AAA_24 AAA_22 AAA_16 NB-ARC ABC_tran Sigma54_activat NACHT MMR_HSR1 PduV-EutP
Motif
Other DBs
NCBI-ProteinID: AOX00087
UniProt: A0A1D8TR51
LinkDB All DBs
Position
3195109..3197838
Genome map
AA seq 909 aa AA seqDB search
MAVPKHIVERIIVAREQQLKQLSLSRAFFYYDGYQLNEILTEIFNLSQLKVLDLSVNKLT
MLPESIGKLTNLTQLYLSSNLLTILPESIGKLTNLTQLYLNSNLLTILPESIGKLTNLTQ
LYLSNNQLITVPESIGKLTKLFELYLSNNQLTTLPESIGKLTKLFELYLSNNQLTTLPES
IGKLTNLTLLNLRENNLTTLPESIGKFTNLTLLDLRENNLTTLPESIGKLSNLTLLDLSN
NELTTLPESIGKLTNLTLLDLSNNELTTLPESLTKLTDLTKLDLRGNPLENPPIEIASNG
IEAIRSYFRQLKEGKDYIYEAKLLIVGEAGAGKTTLAKKIENPNYQLQENEKSTEGIDII
KWKFPLDNGRDFRVNIWDFGGQEIYHTTHQFFLTKRSLYTLVADTRKEDTDFYYWLNIVE
LLSDNSPLLIIKNEKQERHREINERALRGRFTNLKETLATNLATNRGLDDLLTQIKFYIS
NLPHIKEAALPRTWKQVREALEEDSRNYISLDEYLQIGSNNGFTLYNDKLQLSGYLHDLG
VCLHFQDDPLLNKTVILKPEWGTYAVYKVLDNNQVIRNLGCFNRADLEKIWSEENYAYMH
DELLQLMIKFQLCYLIPGRKDNYIAPQLLTLNQPEYDWDESNNLILRYTYDFMPKGIITR
FIVVMHKWIDQQQYVWKSGVILNKDNTKAEVIEYYEQREIKIRVTGRHKRDLLTTVIYEL
DQIHESYNRLRCSKLIPCNCSTCKNSQTPYFYQFDKLRERIGYGQDTIECGSPPYNTVKV
LRLIDDVIGLKQINKDEQPDIYRQLNKADRSIIINNNIDATGSKTMSEKNEIKVGDGSTV
IGAGGKESNNKNLKVTVNESPTEEKWNLSNKLALMGIIATLLVGLGASLFSYFFDNQTPD
PATQQEQVD
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaccaaaacatattgttgagagaataatagtagcaagagagcagcagcttaaa
cagttatctttaagccgtgcttttttttattacgatggttatcagttaaatgaaatctta
actgaaatttttaatttatcacagttgaaagtattggatttaagcgtaaataaattaaca
atgctcccagaatccatcggaaagctgaccaacttaacccagctttatttaagtagtaat
ttattaacaatactcccagaatccatcggaaagctgaccaacttaacccagctttattta
aatagtaatttattaacaatactcccagaatccatcggaaagctgaccaacttaacccag
ctttatttaagtaataatcaattaataacagtcccagaatccatcggcaagcttaccaaa
ttattcgagctttatttaagtaataatcaattaacaacactcccagaatccatcggcaag
cttaccaaattattcgagctttatttaagtaataatcaattaacaacactcccagaatcc
atcggcaagcttaccaacttaaccctgcttaatttaagggaaaataacttaacaacactc
ccagaatccatcggaaagtttaccaacttaaccctgcttgatttaagggaaaataactta
acaacactcccagaatctatcggaaagcttagcaacttaaccctgcttgatttaagcaac
aatgaattaacaacactcccagaatccatcggcaagcttaccaacttaaccctgcttgat
ttaagcaacaatgaattaacaacactcccagaatccctcaccaagcttaccgacttaacc
aagcttgatttaaggggaaatccccttgaaaatccaccaatagaaattgcatcaaatggg
attgaagcaatcagatcttatttccgacaacttaaagaaggaaaagattatatctatgaa
gcaaaactcctgattgtcggtgaagcaggtgctggaaaaacaacactagcaaaaaagata
gaaaacccaaactatcaactacaggaaaacgaaaaatctacagaagggattgacattatt
aaatggaaatttccactggataacggtcgagactttcgggttaatatctgggactttggg
ggacaagaaatttatcacaccacccatcaattcttcctgaccaaacgttccctttacacc
ctagtggcagataccagaaaagaagatacagacttctactactggcttaatatagtagaa
cttttaagcgacaatagtcctctcttaattatcaaaaatgagaaacaagaacgccataga
gaaataaacgagcgcgccttacggggacggtttaccaacttgaaagaaaccctagcaacc
aacctagcgactaaccgaggcttagacgatcttcttacccaaattaaattttatattagc
aacctcccccacatcaaagaagcagctttacctagaacatggaaacaagtcagagaagct
ttagaagaagatagccgtaattacatcagtctggatgaatatctacagatcggctcaaac
aatgggtttactttatacaacgataaattacagttaagcggttacctacacgatctggga
gtgtgtttgcattttcaagatgaccctctattaaataaaacggtgattctcaaaccggaa
tgggggacttatgctgtctataaagtgctggataacaatcaagttattcgcaatctaggt
tgctttaaccgcgctgatttagaaaaaatttggtctgaagaaaactatgcttatatgcac
gatgaactgctacaattgatgatcaagtttcaactttgctatctaatccctgggaggaaa
gataactacattgcgccacaactactaacgttaaatcaacctgagtatgattgggatgaa
tctaacaatctaattctccgctatacctatgacttcatgcccaaaggtattataactcgg
tttatcgtggtaatgcataagtggattgaccagcagcaatatgtctggaaaagtggtgtt
atcttaaacaaagataacaccaaagcagaagtaattgaatattacgaacagcgagaaatt
aaaattagagttactggtagacataaacgagacttgttgactactgttatttacgaacta
gatcagatccatgagtcttataaccgcttgaggtgtagtaagttaatcccctgtaattgt
tctacttgtaaaaacagtcaaactccttatttctatcaatttgataaattaagagagcgg
attggttatggtcaggatacgattgaatgtggtagtcctccctataatacagttaaggta
ttacgtttaattgatgatgtgataggtttaaagcagatcaataaagatgaacaaccagat
atctatcgacagctaaacaaagctgatagatctattattattaataataatattgatgct
acagggagtaaaactatgtctgaaaaaaacgaaatcaaggttggggacgggagtacggta
ataggagcaggaggtaaagagtctaacaacaagaatttaaaagttaccgtcaatgagtca
cccacagaggagaaatggaatctctcaaataaacttgctctgatgggcataatagcgacc
ttattggtaggattaggggcatcgctgtttagctatttttttgataaccagactccagat
ccagcaacacaacaagagcaagtagattaa

DBGET integrated database retrieval system