KEGG   Moorea producens: BJP34_20590Help
Entry
BJP34_20590       CDS       T04499                                 

Definition
(GenBank) glycosyl transferase
  KO
K19003  1,2-diacylglycerol 3-beta-glucosyltransferase [EC:2.4.1.336]
Organism
mpro  Moorea producens
Pathway
mpro00561  Glycerolipid metabolism
mpro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BJP34_20590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mpro01003]
    BJP34_20590
Enzymes [BR:mpro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.336  monoglucosyldiacylglycerol synthase
     BJP34_20590
Glycosyltransferases [BR:mpro01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   BJP34_20590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_tranf_2_4 Chitin_synth_2 Anp1
Motif
Other DBs
NCBI-ProteinID: AOX01523
UniProt: A0A1D8TVF7
LinkDB All DBs
Position
complement(5633802..5635208)
Genome map
AA seq 468 aa AA seqDB search
MSENSWSEKAPSQELNQLGSMLSNLSEEEFETSLFFQGLEGRRRKAALVLTIVWCMTIAL
HLVSWGIWVSLSLTTIVGIHSLRLLLAQPLKTPQPCLDEEKDDFPFVSLLVAAKNEESVI
SNLVQSLCQLDYPKNQYELWVIDDYSTDQTPEILDKLAATYDQLKVLHRSANAGGGKSGA
LNQVLGLTKGEIVAVFDADAKVPKDMLQRVLPLFNNPRVGAVQVRKAIANAALNFWTRGQ
MAEMALDSYFQQQRIAVGGIAELRGNGQFVRRSALQRCGAWNEETITDDLDLTIRLHLDQ
WDIGFLNYPPVEEEGVTSAIALWHQRNRWAEGGYQRYLDYWRLIVSNRLGLRKTIDLFTY
LIIQYFLPTAAVPDCLMAIARNRLPIFSPITGLTVTVSVIGMLVGLRRTNQNRRLRVSNL
LVPLLQTLRGNLYLLHWMLVMAATTARMSVRPKRLKWVKTVHRGGSEE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagaattcctggtcagaaaaagcgccaagccaagagctgaaccaacttggctct
atgctgtctaacttgtcagaggaagagtttgaaactagcttatttttccagggactagaa
ggacgccgacgcaaagcagctttagttttaaccatagtgtggtgcatgacaatagcactg
catttggtgtcttgggggatctgggtgagcttgagcttaacaacgatcgtaggaattcat
tccctacgattattgctggctcaaccgttaaaaacccctcaaccctgtttagatgaggag
aaagacgattttccctttgtgtctctgctagtagcagcaaaaaatgaagaaagtgtcatc
agtaatttagttcagtctctgtgtcaattagactaccccaaaaatcagtatgaactgtgg
gtaattgacgattacagtactgaccaaacaccagaaatcttagataagttagcagcaaca
tacgaccagttgaaggtactgcaccggagtgctaatgccgggggagggaaatcaggagca
ctaaatcaggtactgggtttaacgaaaggcgagattgtagcagtatttgatgcagatgct
aaagttcccaaagatatgctgcagcgggtgttgcccttatttaataacccgcgagtggga
gcagtgcaggtcagaaaagcgatcgcaaatgcagcactgaatttctggacacgagggcaa
atggcagaaatggctctagacagctatttccaacagcaacgtatagcagtgggtgggatt
gctgaattgcggggcaatggtcagtttgtccgacgttccgcactacagcgttgcggtgcc
tggaatgaagaaactatcaccgacgacttagatttaaccattcgcctacacctcgatcag
tgggatattggctttctcaattacccgccagtagaagaagaaggagtcaccagtgcgatc
gcactctggcatcaacggaaccgttgggcagaaggagggtaccagcgctatctagattac
tggcgtttaattgtaagtaaccgcctaggtttgcggaaaactatagatttatttacctac
ttgatcatccagtactttttgcccactgctgctgtaccagactgtttgatggctattgcc
cgtaaccgtctacctatttttagccccattactggtctaactgtcaccgtatcagtgatt
gggatgttggtcgggctgcgccgcaccaatcaaaatcgacgattacgtgtttctaacctg
ttggttcctctgttgcagaccttgaggggaaacctttatctattgcactggatgctagtg
atggccgctactaccgctcggatgtctgtgcgtcctaaacggttgaaatgggtgaaaaca
gtccatagaggtggtagcgaagaatga

DBGET integrated database retrieval system