KEGG   Moorea producens: BJP34_21185Help
Entry
BJP34_21185       CDS       T04499                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mpro  Moorea producens
Pathway
mpro00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mpro00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BJP34_21185
Enzymes [BR:mpro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BJP34_21185
Transporters [BR:mpro02000]
 Other Transporters
  Pores ion channels [TC:1]
   BJP34_21185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C_5 GST_N GST_C GST_N_4 Glutaredoxin GST_C_3
Motif
Other DBs
NCBI-ProteinID: AOX04445
UniProt: A0A1D8U3K0
LinkDB All DBs
Position
complement(5787880..5789103)
Genome map
AA seq 407 aa AA seqDB search
MKPTPMSIAPLTWQELEALTDFQIDTVNGATNAQSCLRLFGFTESDIRVTLYRDNHAWCP
YCQKIWLWLEEKQIPYRIKKITMFCYGKKERWYKQKVPSGMLPALELDGKLITESDDILI
GLERVFKPLEQSMKDPAVIKLRQLERLLFRAWCTWLCYPTRSSKEEQHHQDQFIQVMEMV
ENALSSTPGPYFLDQFGTVDVIFMPYVERMNASLYYYKGYSIREENPRLAAWFEAMETRP
TYRGTQSDFHTHVHDLPPQMGGCWPNDKPQTLVNQARVDNGPWEGLPDVTYPEPETSRTE
ALQRVLKHRTNIIRVNPADETLFDPALRCALTHMITGETCMPPLGSDPALRYLRDRISVP
RDMSIYAAKRLRESLEKTASLVGNGQGSAIPIRHRRDQDPANFAKAI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccacccccatgagcatcgcccccctaacctggcaagaactagaagctctgacg
gattttcaaatagatactgttaatggcgctactaacgctcaatcttgtttgcgcctattt
ggttttactgaatctgatattcgggttaccctataccgggataaccacgcttggtgccct
tactgccagaaaatttggctatggttggaagaaaaacaaattccttatcgtatcaaaaaa
attaccatgttttgttatggtaagaaagaacgttggtacaagcagaaagtgccatcgggg
atgctaccagccctagagctagatggtaaattgattaccgaaagtgatgacattttaatc
ggattagagcgggtttttaaacccttagagcaaagtatgaaagacccggctgtcataaag
ctaaggcagttggagagacttctgtttagagcttggtgtacttggctgtgctatcctaca
cgttcatctaaagaagagcaacatcaccaagaccaatttattcaagtgatggagatggtg
gaaaatgccctaagctccactccaggtccttactttcttgatcagttcggtactgttgat
gtaattttcatgccttatgtggaaaggatgaatgccagtctttattactacaaaggctat
tctatcagggaagaaaacccccgattggcagcttggtttgaagccatggaaacccgacct
acctatcgtggcacacaaagcgacttccacacccatgtccatgatttgcctccccagatg
gggggctgctggccaaacgataaaccccagacgttagtcaatcaggcacgggtagacaat
ggtccttgggaagggctaccggatgtaacttacccagaaccggaaacctcccgtactgaa
gctctccaacgagtgcttaaacaccgcaccaatatcattcgagttaaccccgccgacgag
accttgtttgatccagccctgcgttgtgccttgacacacatgattaccggggaaacctgt
atgccaccgttgggttcagatcctgctcttagatatttgcgcgacagaattagtgttcct
cgggatatgtctatctatgcggctaagaggctcagagagtctctggaaaaaactgcctct
ttagtaggaaatggtcaaggttctgctattcccatccgtcaccgacgtgaccaagatcca
gctaactttgccaaggcgatctag

DBGET integrated database retrieval system