KEGG   Moorea producens: BJP34_23735Help
Entry
BJP34_23735       CDS       T04499                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpro  Moorea producens
Pathway
mpro00010  Glycolysis / Gluconeogenesis
mpro00053  Ascorbate and aldarate metabolism
mpro00071  Fatty acid degradation
mpro00280  Valine, leucine and isoleucine degradation
mpro00310  Lysine degradation
mpro00330  Arginine and proline metabolism
mpro00340  Histidine metabolism
mpro00380  Tryptophan metabolism
mpro00410  beta-Alanine metabolism
mpro00561  Glycerolipid metabolism
mpro00620  Pyruvate metabolism
mpro00625  Chloroalkane and chloroalkene degradation
mpro01100  Metabolic pathways
mpro01110  Biosynthesis of secondary metabolites
mpro01120  Microbial metabolism in diverse environments
mpro01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJP34_23735
   00053 Ascorbate and aldarate metabolism
    BJP34_23735
   00620 Pyruvate metabolism
    BJP34_23735
  Lipid metabolism
   00071 Fatty acid degradation
    BJP34_23735
   00561 Glycerolipid metabolism
    BJP34_23735
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJP34_23735
   00310 Lysine degradation
    BJP34_23735
   00330 Arginine and proline metabolism
    BJP34_23735
   00340 Histidine metabolism
    BJP34_23735
   00380 Tryptophan metabolism
    BJP34_23735
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJP34_23735
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJP34_23735
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJP34_23735
Enzymes [BR:mpro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BJP34_23735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AOX02043
UniProt: A0A1D8TWX1
LinkDB All DBs
Position
6493457..6494842
Genome map
AA seq 461 aa AA seqDB search
MLELQTSQVKDILAQQRNFFSTGKTKDVAFRIAQLKRLKQVILENDTAILEGLKADLHKA
EFESYATEIILVQEIDHTLKHIKSWVKPKRVPVSMANFPGSGQIYPEPLGVVLIISPWNY
PFALAIAPLVGAIAAGNCCVIKPSEISPHTSGAIAEIIQKNFDPSYIAVVEGGVETSQEL
LAEKFDHILFTGSTQVGRIIMTAAAKHLTPVTLELGGKSPCIVETDVPIETTAKRIVWGK
FINAGQTCVAPDYLLVNREIKSDLLQEIKACIHKFYGDDPATSPDYARIISDKHYQRLSS
LLNDGEIIIGGQTNAEDRYIAPTVIDNISLEDKVMEEEIFGPILPVIEYSNLDEAIGIVN
QRPKPLALYFFSRDKSKQQQVLQQTSAGAVCLNETVMHLNVPSLPFGGVGDSGMGAYHGK
AGFDTFSHQKSVLKKSFWLDLQLRYAPYKDKLEQIKKFVSG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaactacaaaccagtcaagtcaaagatattttggctcagcagcgcaattttttc
agcaccggtaaaaccaaagatgtggcattccggatcgcccaactcaagcgcctcaagcaa
gttattttagaaaatgatactgccattttagaagggttgaaagccgacctgcacaaggcg
gaatttgaatcttatgctaccgaaattatcctggtgcaggaaattgatcacaccctcaag
catattaaatcctgggtcaagcccaaaagagtcccggtctcaatggcaaattttccaggc
tctggtcaaatttatcccgaacccttgggagtagtactgattatcagtccctggaactat
ccatttgctctagcgattgcgcctttagtgggtgcgatcgcagcgggaaactgttgcgtt
atcaaaccctctgaaatctcccctcacacctctggtgcgatcgcagagattatccagaaa
aactttgaccctagctatattgctgtagtggaagggggagtagaaaccagtcaggaactg
ttagcagaaaaattcgaccatatcttattcactggcagcacccaagttggcagaattatc
atgactgctgctgccaaacacctaaccccagtcaccctagagttggggggtaaaagtccc
tgcattgtggagacagatgtgccgatagagactacagcaaaacgaattgtttggggtaag
tttatcaatgccggtcaaacctgcgttgcaccagactatctgctggtgaatcgggagatt
aaatctgatttactccaggaaatcaaagcttgtatccataaattttatggagatgatccc
gccacaagtccagattatgctcggattatcagtgataaacattatcagcgtttgagtagc
ttactcaacgatggtgagattataattggtggacaaactaatgcagaagaccgctatatt
gctcccacggtcatcgacaatatttccttagaggataaagtgatggaagaggaaatcttt
ggtccgattctacctgtgattgaatacagtaatttagatgaagcgattgggatagttaac
caaagaccaaaacccttagccctatattttttctccagagacaaatcaaagcaacagcag
gttttgcaacagacctctgctggtgctgtttgcttgaatgaaacagttatgcatctaaat
gttccttccctaccatttggtggggttggtgatagtggcatgggtgcttatcatggtaaa
gctggttttgataccttttctcaccaaaaaagcgtgctgaagaagtccttctggctggat
ttgcagttgcgctatgctccctacaaagacaaactggaacagatcaagaaatttgttagt
ggttag

DBGET integrated database retrieval system