KEGG   Moorea producens: BJP34_25730Help
Entry
BJP34_25730       CDS       T04499                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mpro  Moorea producens
Pathway
mpro00250  Alanine, aspartate and glutamate metabolism
mpro00410  beta-Alanine metabolism
mpro00430  Taurine and hypotaurine metabolism
mpro00650  Butanoate metabolism
mpro01100  Metabolic pathways
mpro01110  Biosynthesis of secondary metabolites
mpro01120  Microbial metabolism in diverse environments
mpro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BJP34_25730
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJP34_25730
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJP34_25730
   00430 Taurine and hypotaurine metabolism
    BJP34_25730
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BJP34_25730
Enzymes [BR:mpro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BJP34_25730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS BTHB
Motif
Other DBs
NCBI-ProteinID: AOX02388
UniProt: A0A1D8TXM4
LinkDB All DBs
Position
complement(7030287..7031699)
Genome map
AA seq 470 aa AA seqDB search
MIEFEKIINLTVDKLLNYLQENKNTDTKVIDYKSPQALKEKLDLSLPENGVPLADLIPII
ESYLDHSVRTSSHKFFNQLWGGFEITGLLAEMVTSTANTSMYTYEVAPVATLIEIKLIEA
LKDLIGFPQGEGLMVTGGSNANLIAMLCARHKLLPEAKNKGLGNHQLVAFISDQAHYSFF
KAANLLGMGIDNVVKVKSDGDQRMCPQQLEAAIQQSLREGKTPFFVTATAGTTVAGAFDP
LPSIAEITSKYGLWLHVDGSWGAPVLFSNQHKHLLEGSSLADSFTWDAHKLMGVPLICSA
ILVKQPGTLLEACSSQGTHYIFHDDEDSAYNLGTMSLQCGRKVDALKLWLAWKYYGKNGY
EARVDRLFELASYAADYIRNCENLELIVQPTFLNICFRYNPRDNSLSNHGLDQLNLEIRE
QLMRSGQALVNYSQYQEQIVIRFILSNPEINEADIDSFLDNFIKIGNSLL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagtttgaaaaaataatcaacttaactgttgataaactccttaactatttgcag
gaaaataaaaataccgacaccaaggtaatagattacaaaagccctcaagcccttaaggaa
aaactcgatttaagcttaccagaaaacggagttcccttagccgatttaattccgattatt
gaatcgtatctcgaccacagcgtgcggactagtagccataagtttttcaaccagctttgg
ggtggatttgagataactggattattagcagaaatggtaactagtactgctaatacttct
atgtatacctatgaagttgctccagtagccacgctgatcgagattaaattgattgaggct
ctcaaggacttgatcggttttcctcaaggtgaggggttgatggtgacaggaggcagtaat
gctaatctgatcgccatgctttgtgcccgacacaaacttctacccgaagccaaaaacaag
ggattgggaaatcaccagctagtagcattcatctccgatcaggctcactattcctttttc
aaagcagcaaatttgttgggcatggggatagacaatgtagtcaaagtcaaatccgatggc
gatcagcgcatgtgcccgcaacaattagaagctgctattcaacaaagcctaagggaagga
aaaacacctttctttgttacagctactgcgggcactaccgttgccggtgcattcgatccg
ttgccctcaattgcagaaattaccagcaaatatggactctggctacatgtggatgggtct
tggggtgctccggttttgttcagcaaccagcacaagcatctgttggaaggtagctcctta
gcagattcttttacctgggatgctcacaaactcatgggcgtgcccttgatttgttcagct
attctagtcaaacaaccagggactttattggaggcttgttctagtcaaggtactcactat
atcttccacgatgatgaagatagtgcctataatcttggaactatgtccttgcagtgtggg
cggaaagtagatgcccttaagctgtggctagcctggaaatactacggcaaaaatggttat
gaagcaagggttgaccgcttatttgaactcgctagctacgcggcggattatattcgcaat
tgtgagaatttagaattgatagttcaaccaacatttttgaatatctgttttcgctataat
cccagggataacagtctgtctaatcatggtttagatcagctaaatctggagatacgtgag
caattaatgcgctctggtcaagcattagtcaattactctcagtatcaagaacagattgta
attcgcttcattctcagcaatccagaaattaacgaagcagatatagatagttttttggat
aactttatcaaaattggtaatagtttattatag

DBGET integrated database retrieval system