KEGG   Moorea producens: BJP34_26565Help
Entry
BJP34_26565       CDS       T04499                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mpro  Moorea producens
Pathway
mpro00630  Glyoxylate and dicarboxylate metabolism
mpro00710  Carbon fixation in photosynthetic organisms
mpro01100  Metabolic pathways
mpro01120  Microbial metabolism in diverse environments
mpro01200  Carbon metabolism
Module
mpro_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mpro_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mpro_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BJP34_26565
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BJP34_26565
Enzymes [BR:mpro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BJP34_26565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AOX02531
UniProt: A0A1D8TXZ0
LinkDB All DBs
Position
7230909..7231256
Genome map
AA seq 115 aa AA seqDB search
MKTLPKERRYETLSYLPPLSDSQIMRQVEYILAEGYIPAIEFNESSEPEIYYWTLWKLPL
FKATSPKDVLAEVDECRSEYRDCYIRVVGFDNVKQCQVLSFIIHKPNDGVSRSRW
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaccaaaagagcgtcgttacgaaaccctttcctacttaccccccctgagt
gactctcagattatgcggcaagtggagtacatcttagcggaaggttacatccctgcgatc
gagttcaacgaaagctctgaaccagagatttactactggacattatggaaactgcctttg
ttcaaggctacttcacctaaagatgtgctagctgaagtggatgagtgtcgctctgaatac
cgcgactgctatatccgggttgtgggttttgataacgttaagcagtgccaagttctcagt
ttcatcattcacaagcctaatgacggtgttagccgcagccgttggtaa

DBGET integrated database retrieval system