KEGG   Moorea producens: BJP34_27460Help
Entry
BJP34_27460       CDS       T04499                                 

Definition
(GenBank) hypothetical protein
Organism
mpro  Moorea producens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Bac_luciferase PP-binding
Motif
Other DBs
NCBI-ProteinID: AOX02681
UniProt: A0A1D8TYF2
LinkDB All DBs
Position
complement(7470994..7474338)
Genome map
AA seq 1114 aa AA seqDB search
MSLVDLLGERAQSQPDQIAYIFLLDGETESQSLTYSELDAKARAIASHLQQWQGERALLL
YPSGLEFISAFMGCLYAGVVAVPVYPPRRNQKLSRLLNIVNDAQACIALTTTSILADLEQ
RWASDGELAQLKLVATDTIVANPLGALSVGELNSPRVAPQDLVPLSVTGSSLAFLQYTSG
STGRPKGVMVSHGNIIHNQQIIHQVFGHSKQSIGVSWLPLFHDMGLILNVVQPMYLGFPS
ILMPPVAFLQKPIRWLKAIYNYRATTSGGPNFAYDLCVKKIPEEQLGNLDLSSWDVAFNG
AEPVRAETLNKFGQKFANCGFNYSAFSPCYGMAETTLFATGGQKNHLPVIQAVLAGELEE
NSVVESDISSPESQKLVAVGRPYLNTTVIIVNPESLTPCEPGKVGEIWVRGGSVTSGYWN
RPQATQETFQASLKDTEDGPFLRTGDLGFFSKGELFVTGRLKDLIIIRGRNYYPQDIELT
VEKSHPALRSNCGAAFSHQVEGSERLVVVQEVERTYLRKLNIDEVTEAIHQAVSSEHELV
IDTIVLLKPGRIPKTSSGKIQRSVCRKQFLDGSLQNIVLTKSVQKVQTQVKGIEFSLLYF
SSNSSELTDRKYRLLLEGAKFADQNNFHAVWIPERHFHPFGGLYPEPSVLASAIATITEK
IRIRPGSVVLPLQNPVRVAEQWSVVDNLSEGRVDISFARGWNPNDFVLSPSTYANRTEVM
FDRIKTVQKLWRGESVCLPNGIGEDTEIKIYPLPCQPELPIWITCTGGKERFVEAGAIGA
NILTALLFQPIEELAEKIALYRESRSKNGYDPNSGHVTLMLHTFVSEEMEFVRNKVRQPF
IEYLQSSVDLWRHDSENLDELTASERDKLLAYAFERYFQITALFGTPSSCLSIVNQLKEI
GVDEIACLIDFGIDADSVIGSLDHLNQLRKLANELSDRQTSKEVEWQAMTVNHSLLAVSK
KINKDLSETRATQRVSTQVNEDLLLHGLQAKIAQQIAEFFNIVPGKIEFNKSFFSLGINS
LKAVEFIENLSENFDISVSPTLLFEYPTIAQLSEYLVEVHEIKISHWMTVAEEESNLLWR
DVKQQTYLDSSQGMKPENLEGTEVKESNWIEVEL
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttagttgatttattaggcgaaagagcgcaatctcaacctgatcagatcgcctat
atctttctccttgacggagaaaccgaatcacagagtcttacctactcggaattagatgca
aaagcaagagcgatcgcatctcatctccagcaatggcaaggagaacgggctttattgtta
tacccttctggattagagttcattagcgcttttatgggctgcttatatgccggggttgtg
gcggttccggtttatcctcccaggcgtaatcagaaattgtctcgcttgctaaatattgtt
aatgatgcccaagcgtgtattgcactgaccaccacatcgatactggctgaccttgagcaa
aggtgggcaagtgatggggagttagctcagttgaagttagtagctaccgataccattgtt
gctaatccgttaggtgcgctttccgttggcgaattaaattcgccacgggtcgcacctcaa
gatttagttccattatcagtgacagggtcgagtttagcttttttgcaatatacttccggt
tccacaggaagaccaaagggggtgatggtgagccacggcaatatcattcacaaccagcag
attatccatcaggtatttggtcatagcaaacagagtattggtgtaagttggttgccattg
ttccatgatatgggattgattcttaatgtcgtacagcccatgtatctgggatttcccagt
attctgatgcctccagtggcatttctgcagaagccgattcgttggttaaaggcgatttat
aactatagggcgactaccagtggcggacccaattttgcttatgatttatgtgtcaaaaaa
attccagaagaacaattaggtaatcttgacttgagcagctgggatgtagctttcaatgga
gcggaaccagtacgggcagaaactctgaataaatttggtcaaaaatttgcgaactgtggt
tttaactacagtgccttttctccttgctatggcatggcggagactaccttatttgctacg
ggtggacagaagaatcatttgcccgtgattcaggcagtattggcaggggaactagaagaa
aattcggtagtagagagtgatatttcctccccagaaagtcaaaagttggtggctgttggt
cgtccttacctaaacacaacagtaattatcgttaaccctgagtcgttaactccctgtgaa
ccaggaaaagtaggagagatttgggttaggggtggcagtgtaacgtctgggtattggaat
cgcccccaagcaacacaagaaacttttcaagcttctctaaaggatacagaagacggacct
tttttacgtacaggagatttaggattttttagtaagggggaactttttgttacaggaaga
ctaaaggatctaattataattagaggtcgcaattattatccccaagatattgaactgaca
gtagagaaaagtcacccagctttgcgatctaattgtggagcagctttttctcatcaggta
gaaggatcggagcggttggtggtggtgcaggaagtagagcgtacttatctgcggaaactg
aatatcgatgaagtaacggaggctattcatcaagccgtatcatcggaacacgaactggta
attgatactatagtcttactcaaaccaggacgtattcctaaaacttccagtggcaagatt
cagcgcagtgtttgtcgcaagcaattcctcgatggaagtttgcaaaatatagttttgact
aagtctgtacagaaggttcaaacacaagtcaaaggaatcgagtttagtttactttacttt
tcgagcaactcttcagagcttacagatcgcaaatatcgacttctgctggaaggagcaaaa
tttgcagaccaaaataattttcatgctgtctggataccagaacggcattttcatcctttt
gggggtttatatccagaaccatccgttttagcttctgccatagcaacgatcactgagaag
attcggattagaccaggtagtgttgttttgccactgcaaaatcctgtgcgagttgccgag
caatggtctgttgtggataacttatctgagggtcgagtagacattagttttgctagaggt
tggaaccccaatgactttgtgctttccccttctacttatgccaatcgtactgaagtgatg
tttgaccggattaaaacggtgcaaaaactttggcgaggggaatcagtttgcttacccaat
ggtattggtgaggacactgagattaagatttaccctttgccttgtcaaccagaattgccg
atttggattacttgtactggaggaaaagaaagatttgttgaggctggagctattggagcc
aatattttaacagctctacttttccaacccattgaagagttagctgaaaaaatagccttg
tatcgagagtcaagatccaaaaacggttacgacccaaacagcggtcatgtaactctaatg
ttacatacctttgtgagtgaagaaatggaatttgttcgcaacaaagtacggcaaccgttt
atagagtatctgcaaagttctgttgacttgtggcgacatgattcagagaatctggatgag
ttaacagcatctgaacgggataagttattggcttatgcttttgaaagatattttcagata
accgccttatttggaacacctagtagctgtttgtcaatagtaaatcagttaaaagaaata
ggggttgatgaaattgcttgtctgattgactttggaatagatgcagattcggtaataggt
tctctcgatcatttgaatcaactgcggaaattggctaacgagcttagcgatcgccaaaca
agcaaagaagttgaatggcaagcaatgactgtaaaccattcattgcttgctgtcagcaaa
aaaatcaataaagacttgtcagaaactagagccacccagagagtcagtacacaagttaat
gaggacttattgctccatggattgcaagctaaaatagctcaacaaattgctgagtttttt
aatatagttcccggaaaaattgagtttaacaaaagcttttttagcttgggcataaattct
cttaaagctgtagaatttatagaaaatctgtcagaaaattttgatatttcggtttctccc
accttactctttgagtatccgacaattgcccaactcagcgagtatttggtggaagtgcat
gagattaaaattagccattggatgaccgtggcggaggaagaatctaatttattatggcga
gatgtcaagcagcaaacatatcttgacagtagtcaaggtatgaagccggaaaatctcgag
ggaacagaggtaaaagaaagtaattggatcgaggtagaactatga

DBGET integrated database retrieval system