KEGG   Melissococcus plutonius ATCC 35311: MPTP_0458Help
Entry
MPTP_0458         CDS       T01492                                 

Definition
(GenBank) arabinose-proton symporter
Organism
mps  Melissococcus plutonius ATCC 35311
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_1_like MFS_2 MFS_3 DUF3103 Pec_lyase_N
Motif
Other DBs
NCBI-ProteinID: BAK20937
UniProt: F3Y8V9
LinkDB All DBs
Position
complement(489354..490313)
Genome map
AA seq 319 aa AA seqDB search
MKKEKKISATYIYFFGAFGGILFGYDIGVMTGVLPFLQIDWHLTHNAAIIGWITSSVMLG
AIFGGALAGTLSDKFGRRKMILISSIVFIAGSLLSAVAPNQGQYYLIIVRIGLGLAVGAA
SALVPSYMSEMAPANLRGRLSGINQVMIVIGMLSSYIVDYLLKNLPGTFTWRFMLGAASI
PGLILFLGVLALPESPRFLVQINKIDEAKQVLSYIRKPNEVTNELNEILTTTKQTQQTQH
TTSWRTLLTNKYRPLVIAGIGVAAFQQFQGANAIYYYIPLIVQKATVHAASDDLIWPIIQ
GIISLIGALLFLVIADKFN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagaaaaaaatttctgccacttacatttatttttttggtgcatttggcggc
atattgtttggctacgatattggtgttatgacaggtgtccttccttttttgcaaattgat
tggcatttgacgcacaatgcagcaattatcggttggattacctcctcagttatgttaggt
gccatttttggtggcgctttagctggtacattatccgataagtttggtcgtcgtaagatg
attctaatttcttcaattgtttttatagcaggttcgcttttatctgctgttgcaccaaat
caaggacaatattacttaattattgttagaattggccttggcttagcagttggtgccgct
tccgccttagttccttcctatatgtctgaaatggctcctgccaatttacgtggaaggctt
tcagggatcaaccaagtgatgattgttatcggtatgttgtcttcttatattgttgattat
ttattgaaaaatttaccaggaacattcacttggcggtttatgttaggtgccgcttcaatt
cctggattaatcttatttttaggtgttctagccttgcctgaatctccacgttttttagta
caaatcaataaaatagatgaagctaaacaagtattaagttatattcgcaagccaaatgaa
gtaacaaatgaattaaatgaaattttgacaaccacaaaacaaacacaacaaacacaacat
acaaccagttggagaaccctacttacaaacaagtatcgcccacttgttattgctggaatt
ggtgtagctgcttttcagcaatttcaaggagcaaatgctatttattattatattccacta
attgttcaaaaagctacagtacatgcagcaagtgatgatttgatttggccaattattcaa
ggaatcatttcacttattggtgcactgctttttctagttattgccgataaattcaattga

DBGET integrated database retrieval system