KEGG   Methylovulum psychrotolerans: CEK71_02600Help
Entry
CEK71_02600       CDS       T04929                                 

Gene name
mrcB
Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
mpsy  Methylovulum psychrotolerans
Pathway
mpsy00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mpsy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CEK71_02600 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mpsy01003]
    CEK71_02600 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mpsy01011]
    CEK71_02600 (mrcB)
Enzymes [BR:mpsy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CEK71_02600 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CEK71_02600 (mrcB)
Glycosyltransferases [BR:mpsy01003]
 Polysaccharide
  Bacterial polysaccharide
   CEK71_02600 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:mpsy01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CEK71_02600 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H
Motif
Other DBs
NCBI-ProteinID: ASF45042
UniProt: A0A1Z4BUY5
LinkDB All DBs
Position
627615..629966
Genome map
AA seq 783 aa AA seqDB search
MAEKPTKNRVRYANKKKPKKNRPHWFRHLLLVSCAASGFALMSYLTYLDYDVRQQFDGKR
WAVPARVYADPVELYPGYSLTAEKLEELLQNLHYRKDPRLSLEGSYSRDKQQVRIKTRQF
TFWDDTQNSQSIVVSFNETGIESILPLATASDNEELKDIPILRMDPVQIGNFYPTIKEDR
ILIKLEEAPDALIKGLLASEDRDFYNHFGVSPRGVARAMWVNLRTGYMVQGGSTITQQLA
KNFFLTSERSLQRKVREIFISFILEYRYPKKAILEAYLNEIYLGQDGPNSVNGFGLASEF
YFGNSLKDLPLDQVALLVALVRGPSEYDPRRYPEHALQRRNLILDEMAEQQFITERQAMD
AKAKPLSVIPRKHHTNNRYPGFLDLVKRQLRAAYHEEDLTSEGLQIFTTLDTQIQETAEK
TAAVKLRELEKQPKANDLQTAIVVTRKDSGEIVALVSGRENAEGGFNRALDAVRPIGSLI
KPAIYLTALENPKKYTITTAISDSTIVVRSQSGSDWIPKNYDHREHGSVPLHKALAKSYN
LATVRIGMDIGIAKTAKTLKQLGINKEIDLYPSMLLGSSGLTPLDVTQMYQTIAGGGFLT
PISTIRAVISTDGKHLQSYPFNVKETVDPDATYIVNTILQEVMREGTGSPAYKVFPKDYG
LAGKTGTTNDAKDSWFAGYTGDFLSVVWVGRDDNKPIGLTGATGALPVWLALMRQISTEP
VVLNKPENIRMVAADACGRGREYPFIAGSEPARRTCERAAPEAAPEEEEEQPWTEQFERF
IPD
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacccactaaaaaccgcgtccgctacgcaaacaaaaagaaacccaaaaaa
aaccgcccgcattggtttagacatcttttattggtcagttgcgccgccagcggcttcgcc
ctcatgagctacctgacctatctcgactacgacgtgcgccaacaatttgacggcaaacgc
tgggcggtgccggcgcgggtctacgccgatccggtcgagctttacccaggttacagctta
acggcggaaaaactggaagaattgctgcaaaatttgcactaccgcaaagacccgcgccta
tcgttagaaggctcttacagccgggacaagcagcaagtccgtatcaaaacgcggcaattc
accttctgggacgatacccaaaacagccaaagcatcgttgtcagttttaacgaaaccggc
atagaatccattttgccgttggcgaccgccagcgataacgaagagctgaaagacatcccc
atcttgcgcatggatccggtgcaaatcggtaacttctaccccaccatcaaagaagaccgt
atcctgattaagctcgaagaagccccggacgcgctcattaaaggcttgctggcctcggaa
gaccgtgacttttacaaccatttcggcgtatcgccgcgcggtgtcgccagagccatgtgg
gtcaacctgcgcaccggctacatggtgcagggcggcagcaccatcacccaacaattggcg
aaaaattttttcttaacctccgaacgcagcttgcaacgcaaagtcagggaaatcttcatc
tcctttatcctagaataccgctaccctaaaaaagccattctggaagcctatttaaacgaa
atttacctaggccaagacggcccgaacagcgtcaacggctttggcttagccagcgaattt
tacttcggcaacagcctaaaagacctgcctctggatcaagtggccttgctggtcgcccta
gtgcgcggcccctccgaatacgacccgcgccgctatcccgaacatgccctgcaacggcgc
aacctcatccttgacgaaatggccgagcaacagttcatcaccgaacgccaagcgatggat
gccaaagccaagcctttaagcgttatcccgcgcaaacaccacactaacaaccgctatccg
ggttttttggatctggtcaaacggcaattaagggccgcctatcacgaggaggatcttacc
tccgaaggcctgcaaatcttcaccaccttagatacgcaaatccaagaaaccgccgagaag
accgccgccgttaaattgcgcgaactggaaaagcaacccaaagccaatgacctgcaaaca
gccatcgtcgtcacccgcaaagacagcggcgaaattgtcgccttagtcagtggccgcgaa
aacgccgaaggcggttttaaccgcgcccttgatgccgtgcgccccatcggctcattaatc
aagcccgccatttacctgaccgcactggaaaacccgaaaaaatacaccatcaccaccgcc
atcagcgacagcaccatcgtcgtccgcagccaaagcggcagcgactggataccgaagaac
tacgaccaccgcgaacatggcagcgtcccgctccataaagccctggcaaagtcgtataat
ctcgccaccgtccgcatcggcatggatatcggcatagccaaaaccgccaaaaccttaaaa
caactggggatcaataaagaaatcgacctctacccgtccatgctcctaggctcttccggg
ctgactccgctagatgtcacgcaaatgtaccaaaccatcgcgggcggcggttttttgacc
cccatctccaccatccgcgcggtcatttccaccgacggcaagcacctgcaaagctatccg
tttaacgtgaaggaaaccgtcgaccccgacgcgacctatatcgtcaacaccatactgcaa
gaagtcatgcgtgaaggtacgggctcgcccgcttataaagtcttcccaaaggattacggc
ctggcgggcaaaaccggcacgactaacgatgccaaagacagttggttcgcgggctatacc
ggcgactttctgtcagtggtctgggtcggccgcgatgacaacaaaccgataggcctgact
ggggcgaccggagcattacccgtctggctagctttaatgcggcaaatctccaccgaaccc
gtggtgctgaacaaaccggaaaatatccgcatggtcgccgccgatgcctgcgggcggggg
cgcgaatacccctttatcgccggctccgaaccggcccggcgcacctgtgaacgggccgcc
ccagaagccgcacccgaagaagaagaggaacagccctggaccgaacaatttgaacgcttt
atacccgattaa

DBGET integrated database retrieval system