KEGG   Methylovulum psychrotolerans: CEK71_07345Help
Entry
CEK71_07345       CDS       T04929                                 

Definition
(GenBank) sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
mpsy  Methylovulum psychrotolerans
Pathway
mpsy00270  Cysteine and methionine metabolism
mpsy00920  Sulfur metabolism
mpsy01100  Metabolic pathways
mpsy01120  Microbial metabolism in diverse environments
mpsy04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mpsy00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CEK71_07345
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CEK71_07345
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    CEK71_07345
Enzymes [BR:mpsy01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     CEK71_07345
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     CEK71_07345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: ASF45906
UniProt: A0A1Z4BX80
LinkDB All DBs
Position
complement(1619732..1620577)
Genome map
AA seq 281 aa AA seqDB search
MNYTTLISASQLQAQLGHPDWVIVDCRFSLADSDAGRNAYQFGHIPTARYADLNKDLSSA
ITDQTGRHPLPDFRVLAKALGAWGISNYSQVVVYDDAAGAFAGRLWWLLRAMGHRNVAVL
DGGINYWRQQGLAITTVLPQVKPCVFRPYLDTSTWLDARAVENGLATAKLCLIDARTPER
YRGEQEPIDPVAGHIPGALNRPFQWNLAQDGRFLPADVLRGQFTALLGKFAPEAVAHNCG
SGVTACHNILAMEVAGLLGSKLYAGSWSEWIRDGNRGVARG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaactataccaccctaatttccgccagccaattgcaagcccagttaggccatcccgat
tgggttatcgtcgattgccggttttctttggcggatagcgatgcaggccgtaacgcctat
cagttcggccatatccccaccgcccgttatgccgatttgaataaggatttgtcctccgcc
atcaccgaccagacgggtcgccatccgttgccggattttcgggtgttggcgaaggctttg
ggcgcgtggggtatcagcaactatagccaagtggtggtgtacgatgatgcggctggcgcg
tttgccgggcggttatggtggttgttacgcgctatggggcaccgtaacgtcgcggtgttg
gatggcggcattaattattggcggcaacaaggcttggcgatcaccacagtattgccgcaa
gtgaagccttgcgtgtttaggccgtatctggataccagcacttggctggatgcgcgggct
gtggaaaatggtttggcgacggccaagctgtgcctgattgatgcccgcacccccgaacgt
tatcgcggtgagcaggaaccgatagatccggtggcgggacatatcccaggggcgttaaac
cgccctttccaatggaatttggcgcaagacggacggtttttgcccgctgacgtgttgcgc
gggcagtttaccgctttgctgggcaaatttgcccctgaagcggttgcgcataactgcggc
tctggcgtgacggcttgccataatatcttggcgatggaagtggcgggtttactggggtct
aagctatatgccgggtcttggagcgagtggattcgggatggcaataggggagtggcgcgg
ggatga

DBGET integrated database retrieval system