KEGG   Methylovulum psychrotolerans: CEK71_07350Help
Entry
CEK71_07350       CDS       T04929                                 

Definition
(GenBank) NAD(P)H-quinone oxidoreductase
  KO
K00344  NADPH:quinone reductase [EC:1.6.5.5]
Organism
mpsy  Methylovulum psychrotolerans
Brite
KEGG Orthology (KO) [BR:mpsy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CEK71_07350
Enzymes [BR:mpsy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     CEK71_07350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N AlaDh_PNT_C adh_short
Motif
Other DBs
NCBI-ProteinID: ASF48674
UniProt: A0A1Z4C5E2
LinkDB All DBs
Position
complement(1620574..1621545)
Genome map
AA seq 323 aa AA seqDB search
MRVIEINQTLLTPSERAVPVPSGQQVLVRVAAAGVNRPDVMQRQGLYPPPPGASDIPGLE
IAGTVVAVGDEVKHVRVGDAVCALVTGGGYAEYCLATAALCLPVPSGLSFVEAAALPETF
FTVWSNVFDRARLAAHETLLVHGGGSGIGTTAIQLAKALGANVYVTAGSEQKCQLCRALG
ADAAINYHDQDFVDQILALTAQRGVDVVLDMVGGAYLARNVKCLAEEGRLVQIAVQQGAK
AELNLWAVMLKRLTLTGSTLRAQDDGFKAAIARQLYQTVWPLLAAGTVKPIIHATFPLNQ
AALAHDMMESNQHFGKIILQVAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttattgaaattaaccagacgctgttaacgccctccgaacgcgctgtgcctgtg
ccttcggggcagcaggttttagtgcgggttgccgccgccggtgtcaaccgcccggatgtg
atgcagcggcaggggctgtatccgccgccgcccggtgcgtcggatattccggggttggaa
atcgccggaacggtggtggcggtgggtgatgaggtgaaacatgtccgggtcggtgatgcg
gtgtgcgctttggtgacgggcggcggttatgccgaatattgtctggcgacggcggcttta
tgcttgccggtgccgtcgggtttgtcgtttgttgaagcggcggctttgccggaaacattt
tttaccgtctggagtaatgtctttgaccgcgcccgtttagccgcccacgaaaccttgttg
gtgcatggcggtggtagcggtatcggtacgacagcgatacagttggctaaggccttaggg
gctaacgtttatgtgacggcggggtctgagcaaaaatgccagttgtgccgggctttgggc
gctgatgcggcgattaattatcatgaccaggattttgttgaccaaatcttagcgttaacg
gcgcagcggggcgttgatgtggtattggatatggtcggcggcgcgtatctggcgcgtaat
gtcaaatgcttggccgaagagggcaggttagtgcaaatcgccgtgcagcagggcgcaaaa
gccgagctgaatttgtgggcggtgatgttaaaacgcctgaccttgaccgggtctacctta
agggcgcaggatgatggttttaaggccgccattgcccggcaactctatcaaaccgtttgg
cctttgttggcggcaggtacggtcaagccgattatccatgccacttttccccttaaccaa
gccgcgctggcgcatgacatgatggagagcaaccagcatttcggcaaaatcatcttacag
gtcgctttatga

DBGET integrated database retrieval system