KEGG   Methylovulum psychrotolerans: CEK71_07355Help
Entry
CEK71_07355       CDS       T04929                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
mpsy  Methylovulum psychrotolerans
Pathway
mpsy00220  Arginine biosynthesis
mpsy01100  Metabolic pathways
mpsy01110  Biosynthesis of secondary metabolites
mpsy01210  2-Oxocarboxylic acid metabolism
mpsy01230  Biosynthesis of amino acids
Module
mpsy_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mpsy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CEK71_07355
Enzymes [BR:mpsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     CEK71_07355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC GFO_IDH_MocA Sacchrp_dh_NADP DapB_N F420_oxidored NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ASF45907
UniProt: A0A1Z4BX78
LinkDB All DBs
Position
1621671..1622711
Genome map
AA seq 346 aa AA seqDB search
MIKAGIVGGTGYTGVELLRILARHPDVEVSVVTSRADAGVRVDTVYPSLRNFVAVSFSQP
EIDTLAQCDVVFFATPNGTAMQMAEALLARGIKVIDLSADFRLQNIPEWEQWYGMTHACP
DLVKHAVYGLPEVNRAAIQQAQLVACPGCYPTAVQLGFLPLIENRLIDTQQLIADVKSGV
SGAGRKAELATLMSETGESFKAYGVGGHRHLPEIRQGLSHAAGETVQLTFVPHLTPMIRG
IHATLYSQINASADTLQAIQALYEQRYQHEAFVDVLPQGAHPDTRNVRGSNNCQIALHQP
QGGNTLVVLSVIDNLVKGASGQAVQNMNLMFGLAETTGLDIVALYP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggcaggtattgtaggcggcaccggttatacaggtgttgaactgttacggatt
ttagcacggcatccagacgttgaagtcagcgtcgtcacctcccgcgccgatgccggggtg
cgcgtcgatacggtataccctagcctacgcaacttcgtggccgtcagcttcagccaaccg
gaaatcgacaccttagcccaatgcgacgtggtctttttcgccacccccaacggcaccgcc
atgcaaatggccgaagccttactggcacgcggcataaaagtcatcgacctgtccgccgat
tttagattgcaaaatatccccgaatgggagcaatggtacggcatgacccacgcctgcccc
gacttggtaaaacacgccgtctacggcctgcccgaagtcaaccgcgccgccatccaacaa
gcccaactggtcgcctgcccaggttgctacccgaccgccgtgcaactgggctttttaccg
ctgatcgaaaaccgcctgatcgacacccagcagctgattgccgacgtaaaatccggagtc
agcggtgccgggcgcaaagccgaactggcgaccttaatgagcgaaacgggcgaaagcttt
aaagcctatggcgtcggcggccatcggcacttgccggaaattcgccaaggcctcagccat
gctgctggcgaaaccgtgcaactgacctttgtcccgcacctgaccccaatgatacgcggc
atccatgccaccttatactcgcaaatcaacgccagtgcggataccctgcaagccatccaa
gccctatatgagcaacgctaccaacacgaggcctttgtcgatgtcctgccgcaaggtgcc
catcccgacacccgcaacgtgcgcggcagcaataactgtcaaatcgccctgcaccaaccc
caaggcggcaacaccttagtcgtgctgtcggtcatcgacaacctcgtcaaaggcgcgtca
ggacaagccgtgcagaacatgaacctgatgttcggcttggcggaaacaacgggactggat
attgtggcgttatatccgtaa

DBGET integrated database retrieval system