KEGG   Methylovulum psychrotolerans: CEK71_07580Help
Entry
CEK71_07580       CDS       T04929                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mpsy  Methylovulum psychrotolerans
Pathway
mpsy00020  Citrate cycle (TCA cycle)
mpsy00190  Oxidative phosphorylation
mpsy00650  Butanoate metabolism
mpsy01100  Metabolic pathways
mpsy01110  Biosynthesis of secondary metabolites
mpsy01120  Microbial metabolism in diverse environments
mpsy01130  Biosynthesis of antibiotics
mpsy01200  Carbon metabolism
Module
mpsy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mpsy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mpsy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mpsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CEK71_07580
   00650 Butanoate metabolism
    CEK71_07580
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CEK71_07580
Enzymes [BR:mpsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CEK71_07580
    1.3.5.4  fumarate reductase (quinol)
     CEK71_07580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ASF45951
UniProt: A0A1Z4BXF8
LinkDB All DBs
Position
complement(1667920..1669704)
Genome map
AA seq 594 aa AA seqDB search
MATSYKIIEHAYDVIVVGAGGAGLRATFGMAEKGLKTACLTKVFPTRSHTVAAQGGISAA
LGNMGEDDWRFHMYDTVKGSDWLGDQDAIEYMCREAIPAVIELEHYGVPFSRTAEGKIYQ
RAFGGMTTHYGKGQAQRTCAAADKTGHAILHTLYQQALKHNAEFFVEYIALDLIMQDGEC
RGVLAWCLDDGSLHLFKAHQTVLATGGYGRSYFSCTSAHTVTGDGNAMVLRAGLPLQDME
FVQFHPTGIYGSGCLITEGVRGEGGYLTNSQGERFMERYAPSAKDLASRDVVSRAMTIEI
NEGRGVGKLKDHIYLHIEHLDPAIIHERLPGIAETSKIFAGVDVTKEPIPVLPTVHYNMG
GIPTNYKAEVVTLEAGNPDKIVPGLMAIGEAACVSVHGANRLGSNSLLDLIVFGRSAAIR
CAELIKPGSSHKPLNKDACDQALTRFDKIRNANGSRSSSDIRLDMQRVMQTKAAVFRTQA
TLDEGITAMADISASFADVTVKDKSLIWNTDLVETLELDNLLAQANVTINAAGNRKESRG
GHAREDYPNRDDANWMKHTLTWLTDGKVSIDYRPVHLYTLSDDVEVIPPKERVY
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggctaccagctataaaattattgaacatgcttacgatgtcattgtggtcggtgcgggt
ggtgcgggtttacgcgcgacttttggcatggccgaaaaaggcctgaaaacggcctgcctg
actaaagtcttcccgacccgcagccataccgtcgccgcccaaggcggcatcagcgcggcg
ttaggcaatatgggcgaagatgactggcgtttccacatgtacgatacggtcaaaggctcc
gactggctgggcgatcaggatgccatcgaatacatgtgccgtgaagccattccggccgtg
atagaactggaacattacggcgtacccttctcgcgcacggcggaaggcaaaatttaccaa
cgcgcctttggcggcatgaccacccattacggcaaaggccaggcccaacgcacttgtgcg
gcggcagataagaccggacacgccatcttacataccttgtaccaacaagccttaaagcac
aatgccgaattttttgtcgaatatatcgccttagatttgattatgcaggacggcgaatgt
cggggcgtattggcgtggtgcttggatgacggttccttgcatttgttcaaagcccaccaa
accgtgttggcgacgggcggttacgggcgcagttatttttcctgcacctcagcacatacc
gttacgggtgacggtaatgcgatggtgttacgcgcgggcctgccattacaagatatggaa
tttgtccaattccaccccacgggcatttacggctccggctgtctgattaccgaaggcgtg
cgcggtgaaggcggctatctgaccaactcgcaaggcgagcgttttatggaacgctatgcc
ccgtccgccaaagatttggcctcccgcgacgtggtcagccgcgccatgaccatagaaatt
aacgaaggccgtggggtcggtaagctcaaagaccatatttacctgcatatcgagcattta
gacccggcgattatccacgaacgcctgccggggattgccgaaacatcgaaaatcttcgcg
ggtgtcgatgtcacaaaagagccgattccggtgttgccgaccgtacattacaatatgggc
ggcatccccaccaactataaggccgaagtggtgacgttggaagcgggcaaccccgataaa
attgtccctggcctgatggcgataggcgaagccgcctgtgtatcggtgcatggcgcgaac
cgtttaggctccaactccttgctcgacttgatcgtgtttggccgctctgccgctatccgc
tgcgccgaactcatcaaacccggctcgtcccataaaccactcaataaagacgcgtgtgac
caagccttgacacggtttgacaaaatccgcaacgccaacggcagccgctccagctcggat
atccgtttggacatgcagcgggtcatgcagacgaaagccgccgtgttcaggacacaagcg
accttggatgaaggcataacggcaatggccgacatcagcgcctcgtttgccgatgtaacc
gtaaaagacaagtcgttaatctggaacacggatttggtggaaacgctggagttggacaat
ttgctggctcaagccaatgtcactattaacgccgccggcaaccgtaaggaaagccggggc
ggccatgcgcgggaagattaccccaaccgtgacgatgccaactggatgaaacacaccctt
acttggctgactgacggcaaagtcagcattgattaccgtccggtgcatttatacacctta
tcggatgatgttgaggtgattccgcctaaggagcgggtttactaa

DBGET integrated database retrieval system