KEGG   Methylovulum psychrotolerans: CEK71_07995Help
Entry
CEK71_07995       CDS       T04929                                 

Definition
(GenBank) amylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mpsy  Methylovulum psychrotolerans
Pathway
mpsy00500  Starch and sucrose metabolism
mpsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CEK71_07995
Enzymes [BR:mpsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CEK71_07995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-ProteinID: ASF48680
UniProt: A0A1Z4C590
LinkDB All DBs
Position
complement(1762186..1764690)
Genome map
AA seq 834 aa AA seqDB search
MPLSATLHAEDAPCPPGYSSTWGPAAKDFLGTSLGATSRVYFTGAEGILTEVFYPTIDTV
QNVDMQFLVTDAAKTWGDEERKQAKHEISQTDPRAMIWNAATTADNGKWKISKKIFTDPN
SNVVIQRVTFQTLEAGKSVKDYNVYLLNNPAINNSGAGKAQCSGKQSTTDGADNSKTLST
SGRTFLVASESKANSAVSALAVSLPWRVTGSDPMVSNGFVGTNDGYTDLFAGVHDRTMDW
HYANALGGNVAQMGWLDFSAATGSSVSFDVVLGFGASENEAMNTANAALKNDLAAIEKTY
ADQWKTYTQGLDNQGGTADNQYYLAAMTLKSIQDKSSGAMVAGPGTPWGDTSNDSNQGGY
HLVWARDLFKFASALITAGDKDTANKSVEFLFNVQMETTGATAGRFPQNSFVDGKPYWNG
TQMDEAAMPIILAWKLNRTDLWPKIKLAAEFVAKTGPHTGQERWEEMGGYSPSTIAAEIA
GLVCAADLATAAGDPGAAAYYLQKADEWRNNIANWTFTTTGYYGNKQYYVRIDSNQNPDD
EDSLTFGNGGGNHKEKSIIDGGFLELVRMGAMSPNDWTILDTLPEYDELLKQTFPGKGDA
FFRYNNDGYGENNQGGSYNGTGRGRLWPIFTAERGIYEIAKSGDGSKGTAYLSALKAFSS
PAGFIPEQIWNQTATITGWETITPAPYVPGTATRSMQPLSWAMGEYINLTAAIKSGKGDA
PKVVCDRYACDKPQVTVSFNATAQTQWGENIYLVGDSPLLSNWIPASGIKLSAKGYPVWS
TRISLPTNTAFKYKYVKRDSKGNTLWEQNADHTFTTAANNTPIVRTDSVQGWQP
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgtccgcgacccttcatgccgaagatgccccttgcccgcccggctattcctca
acgtggggacctgccgctaaagactttctcggcacatcattaggtgctacatcacgggtt
tattttacgggggcggaaggtatcctaaccgaagtgttctatccgaccatcgacaccgtg
caaaatgtcgatatgcagtttttggtcaccgatgccgccaaaacctggggcgatgaagag
cgcaaacaagccaagcatgaaatcagccaaaccgatccacgcgcgatgatttggaatgcg
gcgactaccgccgataacggcaaatggaaaatcagcaaaaaaatatttaccgacccgaac
agtaatgtggtcattcagcgcgtgactttccaaaccttggaagcgggcaaaagtgtgaaa
gattataacgtctatttgctgaacaaccccgccattaacaattccggggcgggtaaggca
caatgtagcggcaaacaaagcaccactgatggcgccgataactcgaaaaccttaagcaca
tcggggcgcactttcttggtcgcttcggaaagcaaagccaattcggcagtatccgcctta
gcggtctccttaccttggcgggtaacgggcagcgacccaatggtatctaacggctttgtc
ggcactaacgacggttataccgatttgttcgcaggcgttcatgacagaaccatggactgg
cattatgccaatgctttaggcggtaacgtcgcgcaaatgggctggctggatttttccgcc
gcaaccggcagttcagtcagttttgatgtggtgctgggctttggcgccagcgaaaacgaa
gcgatgaacaccgccaacgccgccctgaaaaacgatctggcggcaatcgaaaaaacctat
gctgaccaatggaaaacctatacccaaggccttgacaaccaaggcggtacggcggataac
cagtattatctggcggcaatgaccttaaaaagcatccaagacaaaagtagcggcgcaatg
gtggcaggtcccggtacgccgtggggcgataccagcaacgacagcaaccaaggcggctac
catttagtctgggcgcgagatttgttcaaatttgccagcgccttaatcacagcgggcgat
aaagacaccgccaataaatcggtcgaatttttgttcaatgtacaaatggaaaccacgggg
gctacagctggccgttttccgcaaaacagttttgtcgacggcaaaccttattggaacggc
acccaaatggacgaagcggcgatgccgatcattttggcgtggaaacttaaccgcaccgat
ctttggccgaaaataaaattggcggcggaatttgtcgccaaaaccggcccgcatactggg
caagagcgctgggaagaaatgggcgggtactcaccttcgaccattgccgccgaaattgcc
ggactagtctgtgccgccgatttggcgacggcggcgggcgatccgggtgcggcggcgtat
tatctgcaaaaagctgacgaatggcgcaacaatatcgccaattggacatttaccaccaca
ggctattatggcaataaacaatattatgtccgtatcgacagcaaccaaaaccctgacgac
gaagatagcctgactttcggtaacggtggcggcaaccataaagaaaagtcgattattgac
ggcggcttcttagaattggtgcgtatgggggcgatgagtccgaacgattggacgattttg
gacaccctgcccgaatatgatgaacttctgaagcaaacgttccctggcaaaggtgatgct
tttttccgttataacaatgacggctatggcgaaaataaccaaggcggcagttacaatggc
acggggcgcggacgtttatggcctatttttacggcggaacggggtatttacgaaatcgcc
aaaagcggcgacggcagtaaaggcacggcgtatctgagtgccctgaaagccttctcatca
cctgcgggctttatccccgaacaaatctggaatcagaccgcaaccattacgggctgggaa
accatcacgccagccccttatgtccccggcacggcgacccgttccatgcagcctttaagt
tgggcgatgggcgagtatatcaacctgaccgctgcgattaagtctgggaaaggcgatgcc
cctaaagtggtgtgtgaccgttatgcctgcgataaaccgcaagtgaccgtcagttttaat
gccactgcgcaaacccagtggggagaaaatatttatctggtaggcgacagccctttactg
agcaactggatacccgcttcgggcatcaaactatcggcaaaaggctatccagtttggagt
acgcgcatttccttaccgacgaataccgcgtttaagtataaatatgtcaaacgtgacagc
aaaggcaatacgctatgggagcaaaatgccgaccatacatttacaacggcggcgaataat
acgcctatcgtgcggacagatagtgtacagggctggcaaccttag

DBGET integrated database retrieval system