KEGG   Methylovulum psychrotolerans: CEK71_19385Help
Entry
CEK71_19385       CDS       T04929                                 

Definition
(GenBank) hypothetical protein
  KO
K18626  trichohyalin
Organism
mpsy  Methylovulum psychrotolerans
Brite
KEGG Orthology (KO) [BR:mpsy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpsy04812]
    CEK71_19385
Cytoskeleton proteins [BR:mpsy04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    CEK71_19385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ASF48058
UniProt: A0A1Z4C3G5
LinkDB All DBs
Position
4316782..4318698
Genome map
AA seq 638 aa AA seqDB search
MKTVLLIATLSVAALAATSCDTANRDTPAPQAQATATPPEPQPPDNAATVTESKPLVSDL
PATPPPATELAEQDGQPSWEAQVLATEQQAQQQARAQQEHEARQQAVQQAQARLQAIREQ
AALARERTAATAQPQALALPLPAATYPQHACQTQPSPKHSTRHHRRKLSRAQRQAAALRE
EQRLAEERRIRDLSDQEYHFKQQAEAAQAQAKALAEQQEKLRKQQQEEIKRFEELAKKDR
EAQEQHYREEQAQRERQVQALKDQQEQLRKLEEENKRLEEKAKKDREAQEQHEREEQAQR
EREREARDKALKEQQEQQRKLEEDNKRREEQAKKDREAQEQHFREEQAQREREREARDKA
LKEQQEQQRKLEEESKRREEKAKKDREAQEQHEREEQVQREREREARDKSSKDQQEQLHK
LEEENKRREEKAKKDREAQEQHDREEQAQRERETQARDKALKEQQEQQHKLEEDSKRREE
QAKKDREAQEQHFREEQAQREREAQARDKALKEQQEQQRKLEEESKRREEQAKKDREAQE
QRFREEQAQREREAQARDKALKEQQEQQRKLEEESKRREEQAKKDREAQEQRFREEQAQR
EREAQAREKALKEQQEQLNKLAEEAKRREEQARSQMPH
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtattacttatcgccaccttaagcgtggcggcattggcagcgacctcgtgc
gacaccgccaaccgcgacaccccagccccgcaggcgcaggccacagccaccccgcccgaa
ccgcaacctccagacaacgccgccactgtcacagaatctaagccgttagtgtctgattta
cccgcaacgccgccgcccgctaccgaattagccgagcaggacggacagcccagctgggaa
gcgcaagtgctggccactgaacagcaggcgcaacagcaagcccgcgcccaacaagaacat
gaagcccggcagcaggccgtccaacaggcacaagcgcgtctacaagccatccgcgagcaa
gccgctttagccagagagcgcaccgctgccaccgcccaaccgcaagccttagccttgccg
ctgcccgccgccacctacccgcaacacgcctgccaaacccagccatcgcccaaacactct
acccgccatcatcgccgcaaactcagccgcgcccaacggcaagccgccgcgttgcgcgaa
gagcaacggctggcggaagaacggcgaattagagacttgtctgatcaagaataccacttc
aaacaacaagctgaagcggcgcaagcacaggcaaaagccctggcagaacaacaggaaaaa
ctccgcaaacagcagcaagaagaaatcaaacgctttgaagaactggctaaaaaagaccgc
gaagcccaagagcagcattaccgcgaagaacaggcgcaacgcgaacgccaggtgcaggct
ttgaaagaccaacaggagcaattgcgcaagctggaggaagaaaacaaacgccttgaggaa
aaagccaagaaagaccgcgaagcccaagagcagcatgagcgcgaggaacaggcgcaacgc
gaacgcgagcgcgaagcgcgggacaaagccttaaaagagcagcaggagcaacaacgcaaa
ctggaagaagacaacaaacgccgtgaggaacaagccaagaaagaccgcgaagcccaagaa
cagcacttccgcgaggaacaggcgcaacgcgagcgcgagcgcgaagcgcgggacaaagcc
ttaaaagagcagcaggagcaacaacgcaagctggaagaagaaagcaaacgccgtgaggaa
aaagccaaaaaagaccgcgaagcccaagaacagcatgagcgcgaggaacaggtgcaacgc
gaacgcgagcgcgaagcgcgggataaatcgtcaaaagaccaacaggagcaattgcacaag
ctggaggaagaaaacaaacgccgtgaggaaaaagccaaaaaagaccgcgaagcccaagag
cagcatgaccgcgaggaacaggcgcaacgtgaacgcgaaacgcaagcgcgggacaaagct
ttaaaagagcagcaggagcaacaacataagttggaggaagacagcaaacgccgcgaagaa
caggccaagaaagaccgcgaagcccaagaacagcacttccgcgaggaacaggcgcaacgc
gagcgcgaggcgcaagcgcgggacaaagcgttaaaagagcagcaggagcaacaacgcaaa
ctggaagaagaaagcaagcgccgtgaagagcaggccaagaaagaccgcgaagcgcaggag
cagcggttccgcgaggaacaggcgcaacgcgagcgtgaggcgcaagcgcgggacaaggct
ttaaaagagcagcaggagcaacaacgcaaactggaagaagaaagcaagcgccgtgaagag
caggccaaaaaagaccgcgaagcgcaggagcagcggttccgcgaagaacaggcgcagcgc
gagcgcgaggcgcaagcgcgggaaaaagccttaaaagagcaacaagagcaactgaacaaa
ttggcggaagaagccaaacgccgtgaagaacaagcacggagccagatgccgcattaa

DBGET integrated database retrieval system