KEGG   Methylibium petroleiphilum: Mpe_A1478Help
Entry
Mpe_A1478         CDS       T00470                                 

Gene name
cbbL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00630  Glyoxylate and dicarboxylate metabolism
mpt00710  Carbon fixation in photosynthetic organisms
mpt01100  Metabolic pathways
mpt01120  Microbial metabolism in diverse environments
mpt01200  Carbon metabolism
Module
mpt_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mpt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mpe_A1478 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mpe_A1478 (cbbL)
Enzymes [BR:mpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mpe_A1478 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABM94440
UniProt: A2SFV1
LinkDB All DBs
Position
1594326..1595792
Genome map
AA seq 488 aa AA seqDB search
MNKPMEDAAITDVKKRYSAGVLKYRQMGYWMPDYVPKDTDTICLFRITPQDGVDPVEAAA
AVAGESSTATWTVVWTDRLTACDSYRAKAYKVEPVPGIPGQFFAWVAYDIILFEEGSIAN
MTASLIGNVFSFKPLKAARLEDIRIPVAYVKTFKGPPTGLVVERERLDKFGRPLLGATTK
PKLGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYVMDAVNKASAATGEI
KGSYLNVTAATMEDMYERAEFAKELGSVIVMIDLVIGYTAIQSMSNWARRNDVILHLHRA
GHGTYTRQKNHGVSFRVIAKWMRLAGVDHIHTGTAVGKLEGDPMTVQGYYNVCRDSVTKQ
DLPRGLFFDQDWADLKKVMPVASGGIHAGQMHQLIDLFGDDVVLQFGGGTIGHPQGIQAG
AVANRVALECMVKARNEGRDIKNEGPEILRKAAQFCAPLKQALDTWGEISFNYTPTDTSD
YAVTPGVA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaagccgatggaagacgcagcgatcaccgacgtcaagaagcgctacagcgcgggc
gtcctgaagtaccggcagatgggctactggatgcccgactacgtgccgaaggacaccgac
acgatctgcctcttccgcatcacgccgcaggacggcgtggacccggtggaggccgcggct
gcggtggccggcgagtccagcaccgcgacctggaccgtcgtgtggaccgaccgcctgacg
gcctgcgacagctaccgcgccaaggcctacaaggtggagccggtgccgggcattccgggg
cagttcttcgcctgggtggcctacgacatcatcctgttcgaggaaggctcgatcgccaac
atgacggcgagcctgatcggcaacgtgttctcgttcaagccgctgaaggcggcgcggctc
gaggacatccgcatcccggtcgcctacgtgaagaccttcaagggcccgccgaccggtctg
gtggtggagcgcgagcggctggacaagttcggccgcccgctgctgggcgccacgaccaag
cccaagctgggcctgtcgggtcgcaactacggccgcgtggtctacgagggcctgaagggc
ggcctcgatttcatgaaggacgacgagaacatcaactcgcagcctttcatgcactggcgc
gaccgctacctctacgtgatggacgcggtgaacaaggccagcgcggccaccggcgagatc
aagggcagctacctgaacgtgacggccgcgaccatggaggacatgtacgagcgcgccgag
ttcgccaaggaactgggcagcgtgatcgtgatgatcgacctggtgatcggctacacggcg
atccagagcatgagcaactgggcgcgccggaacgacgtgatcctgcacctgcaccgcgcc
ggccacggcacctacacgcgccagaagaaccacggcgtgagcttccgcgtgatcgccaag
tggatgcggctggccggcgtggaccacatccacaccggcaccgcagtcggcaagctcgag
ggcgacccgatgacggtgcagggctactacaacgtgtgccgcgacagcgtcacgaagcag
gacctgccgcgcggactgttcttcgaccaggactgggccgacctgaagaaggtgatgccg
gtggcgagcggcggcatccacgccggccagatgcaccagctgatcgacctgttcggcgac
gacgtggtgctgcagttcggcggcggcacgatcggccacccgcagggcatccaggccggg
gcggtggccaaccgcgtggcactggaatgcatggtgaaggcgcgcaacgaaggccgcgac
atcaagaacgagggcccggagatcctgcgcaaggccgcgcagttctgcgcgccgctgaag
caggcgctcgacacctggggcgagatcagcttcaactacaccccgaccgacaccagcgac
tacgccgtcacgccgggcgtggcctga

DBGET integrated database retrieval system