KEGG   Methylibium petroleiphilum: Mpe_A2094Help
Entry
Mpe_A2094         CDS       T00470                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mpt  Methylibium petroleiphilum
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mpe_A2094
Enzymes [BR:mpt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Mpe_A2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 DAO HI0933_like Glutaredoxin FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Thi4 K_oxygenase FMO-like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABM95050
UniProt: A2SHL1
LinkDB All DBs
Position
complement(2241124..2242695)
Genome map
AA seq 523 aa AA seqDB search
MLDAALKTQLKSYLEKVEHPIDIVASVDEGDKSQELLALLNDIAELSARITLSVRRDDAE
RKPSFSLNRPGARIGLRFAGLPMGHEFTSLVLALLQVGGHPSKAAAEVIEQVRGLEGDYL
FETFFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVEQRQVMAVPTIFLNGQV
FGQGRMGLEEIVAKLDTGAVKREAAKLSAKAPYDVLIVGGGPAGAAAAIYAARKGIRTGL
AAERFGGQVLDTLAIENFISVKETDGPKFAVALEEHVKAYDVDIMNLQRAEALIPGKPGE
LTEVRFAGGAALKASTVIIATGARWRDMNVPGEQVYRTKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVAHVTLLEFAAELRADAVLQRKLHSLPNVKVITQAQTTEVTGDG
HKVNGLTYTDRASGEVHQLTLEGVFVQIGLLPNTDWLKGTVELSRHGEVIVDARGQTSVP
GVFAAGDVTTVPYKQIVIALGEGSKAALSAFDHLIRSTAPALA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgctgccctcaagacccaactgaagagctatctcgaaaaggtcgaacacccg
atcgacatcgtggcctcggtcgacgaaggcgacaagtcgcaggagctcctggccttgctg
aacgacatcgccgaactctcggcccgcatcacgctctcggtgcgccgtgacgacgccgag
cgcaagccctcgttctcgctgaaccgccccggcgcgcggatcggcctgcggttcgccggt
ctgccgatgggccatgaattcacgtcattggtgctggcgctgctgcaggtcggcggccat
ccctcgaaggcggcggcggaggtgatcgagcaggtccggggactcgaaggcgactacctg
ttcgagaccttcttctccctgagctgtcagaactgccctgacgtcgtgcaggcgctcaac
ctgatggcggtgctgaacccgaacatccgccacgtggcgatcgacggtgcgctgttccag
gccgaagtcgaacaacgccaggtgatggccgtgccgacgatctttctcaacggccaggtc
ttcggccagggccgcatgggcctggaggagatcgtcgcgaagctcgacaccggcgccgtg
aagcgcgaggccgcgaagctcagcgccaaggcgccttacgacgtgctgatcgttggcggc
ggcccggccggcgcggccgctgccatctacgcggcgcgcaagggcatccgcaccggcctc
gcggccgagcgcttcggcggccaggtgctggacacgctggcgatcgagaatttcatctcg
gtcaaggagaccgacggcccgaagttcgccgtcgcgctggaagagcacgtcaaggcctac
gatgtcgacatcatgaatctgcagcgtgccgaggcgctgatccccggcaaacccggtgag
ctgaccgaagtgcgcttcgccgggggcgcggcgctgaaggccagcacggtgatcatcgcc
accggcgcgcgctggcgcgacatgaacgtgcccggcgagcaggtgtaccggaccaaggga
gtgacctactgtccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattccggcgtcgaggccgcgatcgacctggccggcgtggtggcgcacgtc
acgctgctcgagttcgccgcggaattgcgcgccgatgcggtgctgcagcgcaagctgcac
agcctgcccaacgtgaaggtcatcacccaggcgcagacgaccgaagtcaccggcgacggg
cacaaggtcaatggcctgacgtacaccgatcgcgcctccggcgaggttcaccagctgacg
ctcgagggcgtgttcgtgcagatcggcctgctacccaacaccgactggctcaagggcacg
gtggagctgtcccggcacggtgaggtgatcgtcgatgcccgtggccagacctcggtgcct
ggcgtgttcgcggctggcgacgtgacgaccgtgccctacaagcagatcgtgatcgcgctc
ggcgagggctcgaaggcggcgctgagcgccttcgaccacctgatccgctcgacggcgcct
gcgctcgcctga

DBGET integrated database retrieval system