KEGG   Methylibium petroleiphilum: Mpe_A3199Help
Entry
Mpe_A3199         CDS       T00470                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
mpt  Methylibium petroleiphilum
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpt03016]
    Mpe_A3199
Enzymes [BR:mpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     Mpe_A3199
Transfer RNA biogenesis [BR:mpt03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    Mpe_A3199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB Myosin_N RNase_II_C_S1
Motif
Other DBs
NCBI-ProteinID: ABM96152
UniProt: A2SKR3
LinkDB All DBs
Position
3402300..3404357
Genome map
AA seq 685 aa AA seqDB search
MSDTYALFEEAGKFLAGRVMSEAESSLQVELDSGKRVKVKSANALLRFAKPAPAELLAQA
HSLSGEIDLDLIWEVAPDEEFGFDDIAREYFNAQPDAPQRAATLLRLFDAPHYFHRRGKG
RFRKAPEDILKQALVAIERKAQQAAQIESWAVKLAGGHCPAPISEQLYRILFKPDKNGPE
YKAVVEAAKRSHKAPLDLLKDAGAITSPYQFHWKRFLFEFFPKGTAFPPLQAPPIKNDLP
LAAVQAFSIDDSSTTEIDDALSVQGLGSDTIVFGVHIAAPGLAIQPGSAVDQVARTRWST
VYMPGHKLTMLPDEVVQSYTLLEGRDCPAVSVYFSLDAASLTVKAVETKLEQVHIAANLR
HDQLDAVVTEASLAGEAPAGYAFAPELAFAFRLARHLKAQRELVRGKPENFNRPDYNFRL
DGGDAGEPDGSETVVITERKRGSPLDLIVAEAMILANSHWGGWIAECGVPGIYRSQASMA
PGIKVRMGTKPAPHAGMGVKQYTWATSPLRRYVDLVNQWQIIACARHGRTAALAAPFKPK
DAELFSVISGFDAAYTAYNQFQNGLERYWTMRHLEQAGLTELEAAVMKDGLVRADTLPLV
FRALGCESLPRGARVRVRITGADLLTLELHASLVARLDDPATPADDAPVDAEEADEAAEA
AAPLALAIDLQDGDNAADPAPSGAA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatacctacgccctgttcgaagaagccggcaagttcctcgccggccgtgtgatg
tccgaggccgagagctcgctgcaggtggagctcgattccggcaagcgcgtcaaggtcaag
agcgccaacgcgctgctgcgttttgcgaaacctgcgccagccgagctgctggcgcaggcg
cacagcctgtcgggcgagatcgacctcgacctgatctgggaggtcgcgccggacgaggag
ttcggcttcgacgacattgctcgcgagtacttcaatgcccagcccgacgcaccgcagcgc
gcggccacgctgttgcggttgttcgatgcgccgcactacttccaccggcgcggcaaggga
cgcttccgcaaggcgccggaagacatcctgaagcaggccctggtggcgatcgagcgcaag
gcgcagcaggccgcgcagatcgagtcctgggcggtcaagctggccggcggccactgcccg
gcgccgatctccgagcagctctaccgcatcctgttcaagcccgacaagaacggccccgag
tacaaggccgtggtcgaggccgcgaagcgttcgcacaaggcgccgctcgacctgctgaag
gacgccggcgcgatcacgagcccctaccagttccactggaagcgcttcctgttcgagttc
ttccccaagggcacggccttcccgccgctgcaggcgccgccgatcaagaacgatctgccg
ctggccgcggtgcaggctttctcgatcgacgattcgagcaccaccgagatcgacgatgcg
ctgtcggtgcaggggctgggcagcgacaccatcgtgttcggcgtgcacatcgccgcgccg
ggcctggccatccagccgggttcggccgtcgaccaggtggcacgcacgcgctggtccacc
gtctacatgccgggccacaagctgaccatgctgcccgatgaggtggtgcagagctacacg
ctgctcgaagggcgcgactgcccggcggtgtcggtgtacttcagtctcgacgcggcgtcg
ctgaccgtgaaggcggtggaaacgaagctcgaacaggtgcacattgccgcgaacctgcgc
cacgaccagctcgacgcggtggtcaccgaagcctcgctggccggcgaggcgccggccggc
tacgccttcgcgcccgagctcgcgttcgctttccgcctggcccggcatctgaaggcgcag
cgcgagctggtgcgcggcaagcccgagaacttcaaccggccggactacaacttcaggctc
gacggaggagacgccggcgagcccgacggcagcgagacggtcgtcatcaccgaacgcaaa
cgcggttcgccgctggacctgatcgtcgccgaggcgatgatcctcgccaacagccactgg
ggcggctggatcgccgaatgtggcgtgcccggcatctaccgcagccaggccagcatggcg
ccgggcatcaaggtgcgcatgggcaccaagccggcgccgcatgccggcatgggcgtcaag
cagtacacctgggccacttccccgttgcggcgctacgtggacctggtcaaccagtggcag
atcattgcctgcgcgcggcacggccgcaccgcggcgctggccgcaccgttcaagcccaag
gacgccgagctgttctcggtcatctcgggcttcgacgccgcgtacacggcctacaaccag
ttccagaacgggctggaacgctactggacgatgcgtcacctcgagcaggcgggcctgacc
gagctggaggccgcggtgatgaaggacgggctggtccgcgccgacacgctgccgctggtg
ttccgggccctcggctgcgagtcgctgccgcgcggagcgcgggtgcgcgtgcgcatcaca
ggggccgacctgctcacgctggagttgcacgccagcctcgtcgcccggctcgacgatccg
gcgacgccggccgacgatgcgccggtcgatgccgaggaggccgacgaagcggccgaggcc
gccgcgccgctcgcgctggcgatcgacctgcaggatggcgacaatgccgccgacccggcc
ccctccggcgccgcctag

DBGET integrated database retrieval system