KEGG   Methylibium petroleiphilum: Mpe_A3692Help
Entry
Mpe_A3692         CDS       T00470                                 

Gene name
nikE
Definition
(GenBank) ABC type ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mpe_A3692 (nikE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpt02000]
    Mpe_A3692 (nikE)
Transporters [BR:mpt02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Mpe_A3692 (nikE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_22 oligo_HPY AAA_21 TniB AAA_29 AAA_16 Sigma54_activat AAA_7 SbcCD_C AAA_30 AAA_5 AAA_23 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: ABM96645
UniProt: A2SM56
LinkDB All DBs
Position
complement(3903990..3905720)
Genome map
AA seq 576 aa AA seqDB search
MTALLSIDQLRVSFRLGRGAAASRIEAVGRGAQGVSFEIAENSTVALVGESGSGKSVTAM
AVLNLLPENAERQGSIRFRDRELLTAGPAELRALRGREIACVFQDPMSSLNPVFTVGQQL
IEPLVLHLGLGRRAARTRAEALLNEVGLPDPKRRLDAYPHELSGGQQQRVMIAMAIACEP
RLLIADEPTTALDVTIQRQILELLAGLKERHRMSMLFISHDLGVVGEIADHVVVMRQGTV
REQASVERLFTAPQDPYTQALLACRPTLAAPPVRLAVIDDHLADPAAGGARPAVAKDPDA
PVVLQVEALSKSFWLRSGLFGRKAFPAVKDVSFELRRGHTLGIVGESGSGKTTAGLALLR
LHEASGGPTGGRAVFRSAKGGGTHELLQLGKSDWLPMRRRLQVVFQNPYASLNPRFTIGQ
TLVEPMAIHGLERDDAAREARARALLAKVGLDAGAWGKYPHEFSGGQRQRIAIARCLTVD
PEVLVLDEAVSALDVSVQAQVLNLLRDLQDELGLAYVFISHDLAVVRFMADEVLVMKDGE
VVERNTVEALLSAPREAYTQRLLGAIPRGYRGAALA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgctgctgagcatcgaccagttgcgcgtgagcttccgtctcggccgcggcgcg
gcggccagccgcatcgaggcggtcggtcgcggcgcgcagggcgtgagcttcgagatcgcc
gagaacagcaccgtcgcgctggtcggcgaatcgggctcgggcaagagcgtcaccgcgatg
gcggtgctgaacctgctgccggagaacgccgaacgccagggctccatccgattccgtgat
cgtgaactgctcaccgccggaccggccgaactgcgcgcgctgcgcggtcgcgagatcgcc
tgcgtgttccaggacccgatgagttccttgaacccggtgttcaccgtcggccagcaactg
atcgaaccgctggtgctgcacctcggcctcggccggcgtgccgcgcggacgcgcgccgag
gcgctgctgaacgaggtcggcctgcccgatccgaagcgccggctcgacgcctatccgcac
gagctgtcgggcggccagcagcagcgcgtgatgatcgcgatggcgatcgcctgcgaaccc
cggctgctgatcgccgacgagccgacgaccgcgctcgacgtcaccatccagcgccagatc
ctcgagctgctggccgggctgaaggagcggcaccgcatgagcatgctgttcatcagccac
gacctcggcgtggtcggcgagatcgccgaccacgtggtcgtgatgcgccagggcacggtg
cgcgagcaggcgtcggtcgagcgcctgttcaccgcgccgcaggacccctacacgcaggcg
ctgctggcctgccggccgaccctggcagcgccgccggtgcgcctggcggtgatcgacgac
cacctggccgatccggccgccggaggcgctcgccccgcggtggcgaaggacccggacgca
ccggtcgtgctgcaggtcgaggcgctgagcaagagcttctggctgcgctcggggctgttc
ggccgcaaggccttccccgccgtcaaggacgtgagcttcgagctgcggcgcggccacacg
ctgggcatcgtcggcgaatcggggtcgggcaagaccacggcgggcctggcgctgcttcgc
ctgcacgaggcgagcggcgggccgaccggcggccgggcggtgttccgcagcgcgaagggt
ggcggcacgcacgagttgctgcagctcggcaagtccgactggctgccgatgcgccggcgc
ctgcaggtggtgttccagaatccctatgcctcgctgaacccgcgcttcacgatcggccag
acgctggtcgagccgatggccatccacggcctcgagcgcgacgatgcggcgcgcgaggcc
cgggcgcgggcgctgttggccaaggtcggcctcgacgccggtgcctggggcaagtacccg
cacgagttctccggcggccagcgccagcgcatcgcgatcgcgcgctgcctgacggtcgac
cccgaggtgctggtgctcgacgaggcggtctcggcgctcgacgtgtcggtgcaggcccag
gtgctgaacctgctgcgcgacctgcaggacgagctgggcctggcctatgtcttcatcagc
cacgatctggcggtcgtgcgcttcatggccgacgaggtgctggtgatgaaggacggcgag
gtggtcgaacgcaacacggtcgaggccctgctcagcgcgccgcgcgaggcctacacgcag
cgcctgctgggcgcgatcccgcgcggctaccggggcgcggcgctggcctga

DBGET integrated database retrieval system