KEGG   Methylibium petroleiphilum: Mpe_A3746Help
Entry
Mpe_A3746         CDS       T00470                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00330  Arginine and proline metabolism
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01130  Biosynthesis of antibiotics
mpt01230  Biosynthesis of amino acids
Module
mpt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Mpe_A3746
Enzymes [BR:mpt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Mpe_A3746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ABM96699
UniProt: A2SMB0
LinkDB All DBs
Position
complement(3966268..3967089)
Genome map
AA seq 273 aa AA seqDB search
MNHLSSPIAFIGGGNMASALIGGLLRSGVHAHEVLVVEPWAEQRERLKQAFGIVATEQAT
PALADAGLVVWAVKPQIFREAAAPCAPHVGEAAQLSVMAGIRTDAIVAATGNRCVVRAMP
NTPALIGQGIAGLYARPEVDAGQRSSVEALLAPTGATLWVDREADLDAVTALSGSGPAYV
FLFIEALMDAARDMGLTPEQGRALALGTFSGATALAAQSAEPPSVLRERVTSRGGTTHAA
LVAMQADGVPAAIVRAVRAAQRRAVELGDEFGG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacctttcctctcccatcgccttcatcggcggcggcaacatggccagcgcgctg
atcggcggcctgttgcgcagcggcgtgcacgcgcacgaagtcctggtcgtcgaaccctgg
gccgagcagcgcgagcgcctgaagcaggccttcggcatcgtcgccaccgagcaggcgacg
ccggcgctggccgatgccggcctggtggtgtgggccgtgaagccccagatcttccgggag
gcggccgcgccctgcgcgccgcatgtgggcgaggccgcccagctcagcgtcatggcgggc
atccgcaccgacgccatcgtcgccgccaccggcaaccgctgcgtggtgcgggcgatgccc
aacacgcccgcgctgatcggccagggcattgccgggctgtacgcgcggcccgaggtcgac
gccggccagcgcagcagcgtcgaggcgctgctggcgcccaccggcgccacgctgtgggtc
gatcgcgaggccgacctcgacgccgtgaccgccctgtcgggctccggcccggcctacgtg
ttcctgttcatcgaggcgctgatggacgccgcgcgcgacatgggcctgacgcccgagcag
ggccgggcgctggcgctcggcaccttctccggcgccaccgcgctggcggcgcagagcgcc
gagccgccgtcggtgctgcgcgagcgcgtcacctcgcgcggcggcaccacgcatgcggcg
ctcgtcgcgatgcaggccgacggcgtgccggcggcgatcgtgcgcgctgttcgtgcggcg
cagcgccgcgcggtcgagctgggcgacgagttcggcggctga

DBGET integrated database retrieval system