KEGG   Methylibium petroleiphilum: Mpe_B0011Help
Entry
Mpe_B0011         CDS       T00470                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mpt  Methylibium petroleiphilum
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Mpe_B0011
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpt03400]
    Mpe_B0011
Enzymes [BR:mpt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mpe_B0011
DNA repair and recombination proteins [BR:mpt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Mpe_B0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABM96792
UniProt: A2SMK3
LinkDB All DBs
Position
RPME01:7816..10410
Genome map
AA seq 864 aa AA seqDB search
MGRTAPSTQANADTPLSRYNAKRNFKVTSEPAGVPAKRSGKSKALCFVIQKHWASRLHYD
FRLELDGVMLSWAVPKGPSYDPALKQMAIHVEDHPISYNTFEGTIPKGQYGAGTVIIWDR
GTWEPEGDPREGMAKGKLIFKLHGQKLAGLWELVRISKPGEVKQEQWLLLKKRGDAWARP
TSEYDVISALPDSVVEKPLGPVEEREQRAGGTAAGTPGPSGEADLQLAVQAPLPAKLAPQ
LATLASAVPSGGSWIVETKFDGYRMLARVDGDDVRLFTRNGNDWTSKLKTVAAAVKDLGL
DSAWLDGEIVVINQAGVPDFNRLQNAIDNSRSKDISFFVFDVPFLGGMDLRKVPVASRRQ
VLNELFEQRQSEVVRFSEAFDVPPAHMLEAACKMGLEGVMVKRADAPYVSSRTDTWLKLK
CQQRQEFIVVGFTDRAGAPTEVGGLLLGYHEDGKLRYAGSVGTGWNSATGRELRSTLAKL
QVEKPALEAGAVKPGRWSKRPAGVERWVKPTMVVEVAFSEWTPDGHVRHPTFRGVRTDKP
ATQITREKAERPEGPVTETAAAVAGKPRTSVKVTNPDRVIDPSTGFKKVDLVRYYESIAD
WMLPHLKDRPVSLVRAPEGITGEQFFQKHPETKMPGMTELDPALWPGHSSLLAVGSAEAL
VSAAQMNVVEFHTWNSTIKRINEPDRVIFDLDPGEGVSWAHLQEAAVLMHTLLTELGLEA
WLKTSGGKGLHVVVPLAPKLDYDAVKGFSQAAVQHMAKTIPQRFVAKSGGSNRVGRIFID
YLRNGHGQTTASAFSARVRPGMGVSMPVSWEQLRELKSGSQWSIATAREYLSFQKSDPWA
AYWTSKQTLTKAMRLLGYAPKKAA
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaggacggcaccctcgacgcaggccaacgccgacacgccgctgtcgcgctacaac
gccaagcgcaacttcaaggtcacctctgagccggccggcgtaccggccaagcgctcaggc
aaatccaaggcgctgtgcttcgtcatccaaaagcactgggccagccggctccactacgac
ttccgcctcgagctcgacggcgtgatgctgagctgggcagtgccaaaggggccctcctac
gacccggccttgaagcagatggccatccacgtcgaggaccacccgatcagctacaacacc
ttcgagggcacgatcccgaagggccagtacggggccggcacggtcatcatctgggaccgc
ggcacctgggagccggagggcgacccccgggaggggatggccaagggcaagctgatcttc
aagctccacggccagaagctggccggcctctgggagctggtgcgcatctccaagcctggc
gaggtgaagcaggagcaatggctgctgctcaagaagcggggcgacgcctgggcccgcccg
acgtcggagtacgacgtcatctcggccctgccggacagcgtggtggagaagccgctcggg
ccagtcgaagagcgggaacagcgggctggcggaacggcggcgggaacgccagggccgagc
ggcgaagcggacctgcagcttgcggtccaggcgccccttccggccaagctggcgccacag
ctggccaccctggcctcggccgttcccagcggcggctcctggatcgtcgagaccaagttc
gacggctaccggatgcttgctcgcgtcgacggtgacgatgtccggctcttcacccgcaac
ggcaacgactggacgtccaagctcaagaccgtcgccgcggccgtgaaggacctcggactt
gactcggcctggctcgatggcgaaatcgtcgtcatcaaccaggctggcgtgccggacttc
aaccgcctccagaacgccatcgacaacagtcgctcgaaggacatcagcttcttcgtcttc
gacgtccccttcttgggcggcatggacctgaggaaggtgccggtggccagccgccgccag
gtgctcaatgagctcttcgagcagcgccagagcgaggtcgtacggttcagcgaggccttc
gacgtgccgccggcgcacatgctcgaggccgcctgcaagatggggctcgaaggcgtgatg
gtcaagcgcgccgacgcgccctacgtctcctcgcggacggacacctggctgaagctcaag
tgccaacagcggcaggagttcatcgtcgtaggcttcaccgaccgcgccggcgcgccgacc
gaggtcggcgggctactcctcggctaccacgaggacgggaagctgcgctacgccggctcc
gtcggtaccggctggaactcagccaccggccgggagctgcggtcaacgttggccaagctc
caggtcgagaagccggcgctcgaggcgggtgccgtgaagcccggccgctggtccaagcgc
cccgccggcgtcgagcgctgggtcaagcccaccatggtggtcgaggtggccttctctgag
tggacgcccgacgggcacgtccggcatcccaccttccgtggggtccggacggacaagccg
gcaacgcagatcacccgggagaaggcggagcggcccgagggcccggtgaccgagacggcg
gccgccgtggcagggaagcctaggacgagcgtcaaggtgacgaatccggaccgggtcatt
gacccgtcgaccggcttcaaaaaagtcgacctggtgcgctactacgagtccatcgccgac
tggatgctgccgcatctgaaagaccggccggtctcactcgtccgagcgcccgagggcatc
accggcgagcagttcttccagaagcatccggagaccaagatgccgggcatgacggagctg
gacccagctctgtggcccggccactcttcgctgctcgccgtcggcagcgccgaggccctg
gtgtcagcggctcagatgaacgtggtcgagttccacacctggaactccacgatcaagcgc
atcaacgagcccgaccgggtcatcttcgacctcgacccaggagaaggcgtcagctgggct
cacctgcaggaggccgcagtgctcatgcacacgctgctgacggagctcggcctcgaggcc
tggctgaagacaagcggcggtaagggcctccacgtcgtcgtgccgctggcgccgaagctg
gactacgacgccgtgaagggcttctcccaggcggcggtgcagcacatggcgaaaaccatc
ccgcagcgcttcgtcgccaagtccggtggctccaaccgagtcggacgcatcttcatcgac
tacctgcgcaacggtcacgggcagacgacggcatccgcgttctcggcccgggttcggcca
ggcatgggagtgtcgatgccggtgagctgggagcagctgcgcgagctcaagagcgggtcg
cagtggagcatcgcgacggctcgggagtacctgtcgttccagaagagcgacccgtgggcc
gcgtactggacgagcaagcagacgttgaccaaggcaatgagacttctcggctacgccccc
aagaaggcggcatag

DBGET integrated database retrieval system