KEGG   Marichromatium purpuratum: MARPU_07305Help
Entry
MARPU_07305       CDS       T03650                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mpur  Marichromatium purpuratum
Pathway
mpur00620  Pyruvate metabolism
mpur00680  Methane metabolism
mpur01100  Metabolic pathways
mpur01120  Microbial metabolism in diverse environments
mpur01200  Carbon metabolism
Module
mpur_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mpur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MARPU_07305
  09102 Energy metabolism
   00680 Methane metabolism
    MARPU_07305
Enzymes [BR:mpur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MARPU_07305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHF03690
UniProt: W0DYM6
LinkDB All DBs
Position
1585993..1588779
Genome map
AA seq 928 aa AA seqDB search
MNETVDDPVLEHDIELFTRLLGDVLREHSRKRVLVVVERLREGFMQLREGEDETLRARLR
ARIEGLDPQTLAEVIRAFAIYFGLVNTAEELNAHLQRMARVSSGERLWRGSFDDTVRRLA
ADGVAPAPFQSLLEHLVYLPVFTAHPTEARRRTIAEIFRRIFLAGQDLHRHRLNDEERED
KLAEIRAQIQILWKTDEVRVHKPQVTDEVRQGLYFFRESLFGAVPEVYRILEKAVRRVHG
AATAAAVPSLMRFGSWIGGDRDGNPFVCPETTELAVRMHAELALEHYLERVGRLQRMLSH
SSALCEPAPAFLDSLDADEDYWVETMGQSLRRFLNEPYRRKLAMVAHRLEANLARVRARL
AEAETLPAAGYCDARAFLVDLRLIRDSLIHHGDASAAAGPLHDLIRLVETFGFHLVQLDL
RQESSRHTEAVAELFARQPGAPYYLAFDESQRLLALVEAIVHPQPFVIDKATLGAATRET
LETFETIARARAEVGEQAIGQYVISMTHEASHVLEVMLLARLAGLAGRDRQGWFCTLQIA
PLFETIDDLARIDAVMGRLFTDPTYRALLRASGDQQEVMLGYSDSCKDGGILASGWRLYE
AQRKVIALADEHGVACRLFHGRGGTVGRGGGPTHEAILAQPADTVHGQIKFTEQGEVLSY
RYANPETARYELTMGISGLIKASRCLIESAAPERAEDLEVMAELAAHGEAAYRALVGTEG
LLDYFYACTPVDGIALLNIGSRPAHRSRGDRSLSSIRAIPWVFGWGQARLTLPGWFGIGT
ALARYRGDDPERLVRLRRMYGEWPFFRVLLSNTQMSLFKAEMAIAREYLRLADDPPRAAA
LLAHIEAEYRLTLSEVLAVTETDRLLADQPALRRSLLRRNRYLDPLNHIQVVLLERYRGE
PEAEQREQWLDPLLRSINAIAAGMRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaccgtggacgaccccgtgctcgagcacgacatcgagctgttcacccggctg
ctcggcgacgtgttgcgcgagcacagtcgcaagcgcgtgctggtggtggtcgagcgcctg
cgcgagggcttcatgcagctgcgcgagggcgaggacgagacgctgcgcgcgcgcctgcgg
gcgcgcattgaggggctcgacccgcagaccctggccgaggtgatccgcgcctttgcgatc
tatttcggtttggtcaacaccgccgaggaactcaacgcccatctccagcgcatggcgcgc
gtctcctccggcgagcggctgtggcgcggctccttcgacgacaccgtgcgtcggctcgcc
gccgacggggtggcgcccgcacccttccagagcctgctcgagcacctggtctatctgccg
gtgttcaccgcgcaccccaccgaggcgcggcggcgcaccatcgccgagatcttccgccgc
atcttcctcgccgggcaggacctgcaccgccaccggctcaacgacgaggagcgcgaggac
aagctcgccgagatccgcgcccagatccagatcctgtggaagaccgacgaggtgcgggtg
cacaagccacaggtcaccgatgaagtgcgccaggggctctatttcttccgtgagtcgctg
tttggcgccgtgcccgaggtctatcgcatcctcgagaaggcggtgcgccgggtccacggt
gccgcgaccgccgcggcggtgccgagcctgatgcgcttcggctcgtggatcggcggcgat
cgcgacggcaaccccttcgtgtgccccgagaccaccgagctggcggtgcggatgcacgcc
gagctggcgcttgagcactatctcgaacgggtggggcggttgcagcgcatgctcagccac
tccagcgcgttgtgcgagcccgcgccggccttcctcgacagcctcgacgccgacgaggac
tactgggtcgagaccatggggcagagcctgcgccgcttcctcaacgagccctaccggcgc
aagctggcgatggtcgcccaccggctcgaggccaacctggcgcgggtgcgtgcccgtctc
gccgaggccgagacgctgccggcggccgggtattgcgatgcccgcgccttcctcgtcgac
ctccggctgatccgcgactcgctgatccatcacggcgatgccagcgccgccgccgggccg
ctccacgacctgatccgtctggtcgagaccttcggcttccatctggtgcagctcgacctg
cgccaggagtcgagccgccacaccgaggcggtggctgagttgttcgcccgccagcccggc
gcgccctactatctcgccttcgacgagtcgcagcgcctgctcgccctggtcgaggcgatc
gtccacccccagcccttcgtcatcgacaaggcgaccctcggcgcggccacccgcgagacc
ctggagaccttcgagaccatcgcccgggcgcgcgccgaggtcggcgagcaggcgatcggt
cagtacgtgatctcgatgacccatgaggccagtcacgtgctcgaggtgatgctgctggcg
cggctggcggggctcgccggacgcgaccgccagggctggttctgcaccctgcagatcgcg
ccgttgttcgagaccatcgacgacctggcgcggatcgacgcggtgatggggcggctgttc
accgatcccacctatcgcgcgctgctgcgcgcctcgggcgatcagcaggaggtgatgctc
ggctattccgactcctgcaaggacggcggcatcctcgcctcgggctggcgtctctacgag
gcccagcgcaaggtgatcgcgctcgccgacgagcacggcgtggcctgtcggctgtttcac
ggccgcggcggcaccgtggggcgcggcggcgggccgacccacgaggcgatcctcgcccag
ccggccgataccgtgcacggccagatcaagttcaccgagcagggcgaggtgctctcctat
cgctacgccaaccccgagaccgcgcgctatgaactcaccatggggatcagcggtctgatc
aaggccagccgttgcctgattgagtccgccgcgcccgagcgcgccgaggacctggaggtc
atggccgagctggccgcgcacggcgaggcggcctatcgcgcgctggtcggcaccgagggg
ctgctcgattatttctatgcctgcaccccggtcgacggcatcgcgctgctcaacatcggc
tcgcgcccggcgcaccgcagccgcggcgatcgctcgcttagctcgatccgcgccatcccc
tgggtgttcggctggggacaggcgcggctgaccctgccggggtggttcggcatcggcacc
gcgctggcgcgctatcgcggcgacgatcccgaacgcttggtgcggttgcggcggatgtat
ggcgagtggcccttcttccgggtgctgttgtcgaacacccagatgtcgctgttcaaggcc
gagatggcgatcgcccgtgagtacctgcgcctggccgacgacccgccgcgcgccgcggcc
ctcctcgcgcacatcgaggccgagtaccggctgaccctgagcgaggtgctggcggtcacc
gagaccgaccggttgctcgccgaccaaccggcgctgcgccgctcgctgctgcgtcgcaac
cgctatctcgacccgctcaaccacatccaggtggtgctgctcgagcgctatcgcggcgag
cccgaggcggagcaacgcgagcagtggctcgatccgctgctgcgttcgatcaacgccatc
gccgccgggatgcgcaacactggttga

DBGET integrated database retrieval system