KEGG   Marichromatium purpuratum: MARPU_12160Help
Entry
MARPU_12160       CDS       T03650                                 

Definition
(GenBank) peptidase S13
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
mpur  Marichromatium purpuratum
Pathway
mpur00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mpur00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MARPU_12160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mpur01002]
    MARPU_12160
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mpur01011]
    MARPU_12160
Enzymes [BR:mpur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MARPU_12160
   3.4.21  Serine endopeptidases
    3.4.21.-  
     MARPU_12160
Peptidases [BR:mpur01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   MARPU_12160
Peptidoglycan biosynthesis and degradation proteins [BR:mpur01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   MARPU_12160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AHF04511
UniProt: W0E609
LinkDB All DBs
Position
2744204..2745223
Genome map
AA seq 339 aa AA seqDB search
MPASTMKLLTAYAALETWGREHRFHTDIRFDDDGVLWVVGHGDPYLVSEELMRIATAVRA
RGVTRINGLGLDTHALGADTEIPGRSHTSNPYDAPLSALAANFNTVSLVREADGRLRSGE
SQTPLTATARALGAGLGAGRHRVNLVDRARAERHFGELFAALLERAGVSVVGPIRQARAP
RGARLLYRHHNSRTLAEMIAPMLEYSTNFIANGLFIKLSDPKDKGVAGMAEARRTVTRLA
RERLGWRDAVIDDGAGLSRANRLSARQLIELLDAFVPYRDLMPRQDDDPRVLAKTGTLTG
VSSYAGYVRRNGGWGRFALLVEQPVDRGLRQRLASALAR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcctcgacgatgaagctgctcaccgcctatgccgcactcgagacctgggggcgc
gagcatcgcttccacaccgatatccgcttcgacgacgacggcgtcctctgggtggtcggg
cacggcgatccctacttggtctccgaggagctgatgcgcatcgccaccgcagtacgcgcg
cgcggcgtcactcgcatcaacgggctcgggctcgacacccacgcgctcggcgccgatacc
gagatccccgggcgctcacacaccagcaacccctacgatgccccgctgagcgcgctcgcg
gccaacttcaacaccgtgagcctggtacgcgaggccgatggccggctgcgtagcggcgag
tcgcagacgccgctgaccgccaccgcccgggcgctgggcgcaggactcggtgccggacgc
catcgcgtcaatctggtcgaccgcgcccgtgccgagcgtcacttcggcgagttgttcgcg
gccctgctcgagcgcgccggcgtcagcgtcgtcgggccgatccgtcaggcccgggcgcca
cgcggtgcgcggctgctctaccggcaccacaacagccgcaccctcgccgagatgatcgcg
ccgatgctcgagtactcgaccaacttcatcgccaatggcttgttcatcaagctctccgac
cccaaggacaagggagtcgcgggaatggccgaagcgcgacgcacggtgacccggctggcg
cgcgaacgtctcggctggcgcgatgcggtgatcgacgatggcgccggactgtcgcgcgcc
aatcggttgagcgcacgccagctcatcgagttgctcgatgcctttgttccctatcgcgac
ctgatgccgcgccaggacgacgacccgcgagtgctggccaagaccggcaccctgaccggg
gtcagcagctatgccggctatgtccggcgcaatggtggctggggacgcttcgcgctgctc
gtcgagcagccggtcgatcgcggcctgcgccagcggctggccagcgcgttggcgcgctga

DBGET integrated database retrieval system