KEGG   Marichromatium purpuratum: MARPU_13945Help
Entry
MARPU_13945       CDS       T03650                                 

Gene name
chlL
Definition
(GenBank) protochlorophyllide reductase
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
mpur  Marichromatium purpuratum
Pathway
mpur00860  Porphyrin and chlorophyll metabolism
mpur01100  Metabolic pathways
mpur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MARPU_13945 (chlL)
Enzymes [BR:mpur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     MARPU_13945 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 MeaB MipZ AAA_26 ABC_tran CBP_BcsQ SRP54 AAA_25 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AHF04831
UniProt: W0E701
LinkDB All DBs
Position
complement(3150071..3150949)
Genome map
AA seq 292 aa AA seqDB search
MTKYLDGEGSMQVQLDPNLQIESAKVFAVYGKGGIGKSTTSSNLSVAFSKLGKRVLQIGC
DPKHDSTFTLTKCLVPTVIDVLESVDFHAEELRPSDYVYEGYNGVMCVEAGGPPAGTGCG
GYVVGQTVKLLKQHHLLEDTDVVVFDVLGDVVCGGFAAPLQHADRALIVTANDFDSIFAM
NRIAAAIQAKAKHYKVRLGGVVANRSRQTDEIDRFIEAVGLERLAHLPDLDIIRRSRLKK
STVFEMQPEPDSGLEAAQQQYLQLAQQLWDGVEPLDARPMRDRDIFDFLGFD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaagtacctggacggagagggcagcatgcaggtgcagctcgatcccaacctgcag
atcgaatcggccaaggtctttgccgtctacggcaagggcgggatcggcaagagcaccacc
tcgtcgaacctgtcggtggccttctcgaagctcggcaagcgggtgttgcagatcggctgc
gatcccaagcacgactcgaccttcaccctgaccaagtgtctggtgccaacggtcatcgac
gtgctcgagtcggtcgacttccacgccgaggagttgcgtccctccgattatgtctacgag
ggctacaacggggtgatgtgcgtcgaggccggcggtccgcctgccgggaccggttgcggc
ggctacgtggtcggtcagacggtgaagctgctcaagcagcatcatctgctcgaggacacc
gacgtggtggtcttcgacgtgctcggcgacgtggtctgcggcggtttcgccgcgccgctg
cagcatgccgatcgcgcgctgatcgtcaccgccaacgatttcgactcgatctttgcgatg
aaccgcatcgccgcggccatccaggccaaggccaagcattacaaggtacggctcggcggc
gtggtggccaaccgtagccgtcagaccgacgagatcgatcgcttcatcgaggccgtcggc
ctcgagcgtctggcgcacctgccggatctcgacatcatccgtcgcagccgactgaagaag
tcgaccgtgttcgagatgcagccggagccggactccgggctggaggccgcgcagcagcag
tatctgcagctcgcccagcagctctgggacggggtcgagccgttggacgcgcgaccgatg
cgcgatcgcgacatcttcgattttctggggtttgactga

DBGET integrated database retrieval system