KEGG   Marichromatium purpuratum: MARPU_14735
Entry
MARPU_14735       CDS       T03650                                 

Definition
(GenBank) aspartokinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
mpur  Marichromatium purpuratum
Pathway
mpur00260  Glycine, serine and threonine metabolism
mpur00261  Monobactam biosynthesis
mpur00270  Cysteine and methionine metabolism
mpur00300  Lysine biosynthesis
mpur01100  Metabolic pathways
mpur01110  Biosynthesis of secondary metabolites
mpur01120  Microbial metabolism in diverse environments
mpur01210  2-Oxocarboxylic acid metabolism
mpur01230  Biosynthesis of amino acids
Module
mpur_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mpur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MARPU_14735
   00270 Cysteine and methionine metabolism
    MARPU_14735
   00300 Lysine biosynthesis
    MARPU_14735
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    MARPU_14735
Enzymes [BR:mpur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     MARPU_14735
SSDB
Motif
Pfam: AA_kinase ACT ACT_7
Other DBs
NCBI-ProteinID: AHF04958
UniProt: W0E5Y4
LinkDB
Position
complement(3334234..3335463)
AA seq 409 aa
MALIVQKYGGTSVGSVERIQAVAERVKRWHDQGNQVVVVVSAMSGETDRLVGLAKQIQER
PEPRELDVLLSTGEQVTIALLSMALAARGCPARSYTGAQVHILTDSVHNKARIRDIDAAR
VGADLKAGRVVVVAGFQGVDESGDITTLGRGGSDTSAVAIAAALKADECQIYTDVDGVYT
TDPRVEPKARKLDRITFEEMLEMASLGSKVLQIRSVEFAGKYQVPLRVLSSFGEGEGTLI
TFEEDEVEDAKIAGIAFSRDEAKLTILGVPDRPGVAHEILGAIAAANIEVDMIIQNVAAE
EATTDFTFTVQRGDYARALEILQARADALGARQVLGDEQIVKISLVGVGMRSHAGIASRM
FETLAHEGINIRMISTSEIKISVVVDERYLELGVRALHGAFGLDQNGEV
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggcgctgatcgtccagaaatacggcgggacgtcggtcgggagcgtggagcgtatccag
gcagtggccgagcgggtcaagcgctggcacgaccagggcaatcaggtggtggtggtggtc
tcggcgatgtccggcgagaccgaccgtctggtgggcctggccaaacagatccaggagcgg
cccgagccgcgcgaactcgatgtgctgctctccaccggcgagcaggtcaccatcgcactg
ttgagcatggcgctggccgcgcgtggttgtccggcgcgctcctataccggcgcccaggtg
cacatcctcaccgacagcgtgcacaacaaggcgcgtatccgcgacatcgacgcggcgcgt
gtcggggccgatctgaaggcggggcgcgtggtggtggtcgccgggttccagggggtcgac
gagagcggtgacatcaccacgctcgggcgcggcggctcggatacctcggcggtggcgatc
gccgcggcgctcaaggccgacgaatgccagatctataccgacgtcgacggtgtctacacc
accgatccgcgggtcgaacccaaggcgcgcaagctcgatcgcatcaccttcgaggagatg
ctggagatggccagtctcggctccaaggtgttgcagatccgctcggtggagttcgccggc
aagtaccaggtccccctgcgcgtgctctccagcttcggcgagggcgagggcacgctgatt
accttcgaggaagatgaagtggaagacgcaaagatcgccggcatcgccttcagccgtgac
gaggccaagctgaccatcctcggcgtgcccgaccgtcctggcgtggcgcacgagatcctc
ggcgcgatcgcggcggccaacatcgaggtcgacatgatcatccagaacgtcgccgccgag
gaggcgacgacggacttcaccttcaccgtccagcgcggcgattatgcgcgggcgctggag
atcctgcaggcgcgtgccgatgcgctgggcgcgcgtcaggtactcggcgacgagcagatc
gtcaagatctcgctggtcggcgtcggtatgcgcagtcatgccgggatcgccagtcggatg
ttcgagaccctggcacacgagggcatcaacatccgcatgatctcgacctccgagatcaag
atctcggtggtggtcgacgaacgctatctcgaactcggcgtgcgcgcgctgcacggcgcc
ttcggtctggaccagaacggcgaggtctag

DBGET integrated database retrieval system