KEGG   Mycoplasma putrefaciens Mput9231: MPUT9231_1530Help
Entry
MPUT9231_1530     CDS       T02637                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mput  Mycoplasma putrefaciens Mput9231
Pathway
mput00010  Glycolysis / Gluconeogenesis
mput00030  Pentose phosphate pathway
mput00051  Fructose and mannose metabolism
mput00052  Galactose metabolism
mput00680  Methane metabolism
mput01100  Metabolic pathways
mput01110  Biosynthesis of secondary metabolites
mput01120  Microbial metabolism in diverse environments
mput01130  Biosynthesis of antibiotics
mput01200  Carbon metabolism
mput01230  Biosynthesis of amino acids
mput03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPUT9231_1530 (pfk)
   00030 Pentose phosphate pathway
    MPUT9231_1530 (pfk)
   00051 Fructose and mannose metabolism
    MPUT9231_1530 (pfk)
   00052 Galactose metabolism
    MPUT9231_1530 (pfk)
  09102 Energy metabolism
   00680 Methane metabolism
    MPUT9231_1530 (pfk)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    MPUT9231_1530 (pfk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mput01009]
    MPUT9231_1530 (pfk)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mput03019]
    MPUT9231_1530 (pfk)
Enzymes [BR:mput01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MPUT9231_1530 (pfk)
Protein phosphatases and associated proteins [BR:mput01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MPUT9231_1530 (pfk)
Messenger RNA biogenesis [BR:mput03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MPUT9231_1530 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Radical_SAM DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AGJ90591
UniProt: M9WCN0
LinkDB All DBs
Position
172340..173314
Genome map
AA seq 324 aa AA seqDB search
MVKKIGILTSGGDSPAMNNAIAGVVKAAYSKGIEVYGIRDGYKGLYHAWFEKLTVEQTFD
IISKGGTMLGSARFVEFKQESIRQQAVKNLKKAGIEALVVIGGDGSYMGAQKLTEMGINC
IGLPGTIDNDIISSEFTIGFDTALNTVVEAVDKIRDTGQSHHRANVIEIMGNGCGDLVTY
AAVGTAAEIFSPTEDLLTVEEIAQKAKQFYEQGKRSIIILISEKSYDISANQIAKRVQEV
SGYETRATILGHMQRGGRPNAMDRYLAYTSAIYAVEKIVEGKGGLFIGLENNKLVARDIN
ATLNIKAADKKPFIEKLRAVNGYY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaaataggtattttaacttctggaggagactcacctgcaatgaataatgcg
attgccggagttgttaaagcagcctattctaagggcattgaagtctatggaattagagat
ggatataagggtctttatcatgcttgatttgaaaaactaacagttgaacaaacctttgac
attatttcaaaaggtggaactatgctaggttcagctagatttgtggaatttaaacaagaa
agtatcagacaacaagcagttaaaaatttaaaaaaagctggcattgaagcactagttgtg
attggtggagatggaagttatatgggagctcaaaagctaactgaaatgggcattaattgc
atcggattaccaggaactattgataatgacattatttcaagtgaatttactattgggttt
gatactgctttaaatactgtagttgaagctgttgataagattcgtgatactggtcagtca
caccaccgagctaatgtaattgaaattatgggaaatggttgtggagatttagtaacttat
gcagcagtaggaactgcagctgaaatcttttccccaactgaagatttattaacagttgaa
gaaattgctcaaaaagcaaagcaattttatgaacaaggaaaaagaagtatcatcatttta
atttcagaaaaatcatatgatatttcagccaatcaaattgctaaaagagttcaagaagtt
agtggttatgaaactagagcaacaattctaggacatatgcaacgtggaggaagaccgaat
gctatggatcgatatttagcttatacttcagcaatctatgcagttgaaaaaattgttgag
ggaaaaggtggactatttattggtttggaaaacaataaactagttgcaagagatattaat
gccactttaaacatcaaagcagcagataaaaaaccatttattgaaaaactaagagcagtc
aacggttattactag

DBGET integrated database retrieval system