KEGG   Myroides profundi: MPR_0262Help
Entry
MPR_0262          CDS       T03631                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mpw  Myroides profundi
Pathway
mpw00240  Pyrimidine metabolism
mpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MPR_0262
Enzymes [BR:mpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MPR_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AJH13479
UniProt: A0A0B5RWH0
LinkDB All DBs
Position
complement(288310..288876)
Genome map
AA seq 188 aa AA seqDB search
MFSGKTEELIRRLKRAKFAKQKVEIFKPAIDTRYHDEFVVSHDSNEIRSTPVPSAAHIRL
LADGCDVVGIDEAQFFDEEIVRVCNDLANSGIRVIVAGLDMDFKGNPFGPMPYLMATAEY
VTKVHAICTRSGNLANYSFRKAASEDIVMLGETQEYEPLSRAAYFNALRGVDISKSEKQN
TIPPEQIE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgttctctggtaagactgaagaactgattcgcagactgaaaagagccaaatttgccaaa
caaaaagtcgaaatttttaaacctgctatcgatactagatatcatgatgagttcgtcgta
tctcatgattctaatgagattaggtctacgcctgtaccttctgcagcacatatcagatta
ttagctgatggatgtgatgtggtaggaatagatgaagcccaattcttcgatgaagagatc
gtaagggtatgtaatgaccttgctaactcaggtatcagagtgatcgtagctggactagat
atggactttaaaggaaatccctttggaccaatgccttacttaatggctacggcagagtat
gtgactaaagtacatgctatctgtactagatcaggaaatcttgctaattatagcttcaga
aaggctgctagtgaggatatcgtcatgttaggagaaacacaagaatacgagccgctgagt
agagcagcttatttcaatgcactgcgaggtgtagatatatcaaaatcagaaaaacaaaat
acaataccgccagaacaaatagaataa

DBGET integrated database retrieval system