KEGG   Myroides profundi: MPR_0676Help
Entry
MPR_0676          CDS       T03631                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
mpw  Myroides profundi
Pathway
mpw00380  Tryptophan metabolism
mpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MPR_0676
Enzymes [BR:mpw01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     MPR_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Hfx_Cass5 Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AJH13876
UniProt: A0A0B5RLG9
LinkDB All DBs
Position
738794..740071
Genome map
AA seq 425 aa AA seqDB search
MTFENTLAYAKSLDEKDPLAKYRDEFNFPEVNGKQVIYFTGNSLGLQPKRAVEYVNEVMN
DWGALAVEGHFYAEKPWWDYHERLSEPLSRIAGAKSSEITVMNTLTVNLHILMTTFYRPT
ASKYKIICEEKAFPSDQYLIQSQVRLHGLEPKEAIIELKKRPGEHNFRLEDILEKIDEVG
EEVALVLIGGLNYYTGQVFDIKTITAHAHQYGAKVGWDLAHAAGNIELKLHEWNVDFAAW
CSYKYMNAGPGSASGCFIHERYHTDKDLIRLAGWWGHNKERRFLMEKKFDAVESAHGWQI
SNPSILSLAPYLASIEMFDEVGMEALITKQREITAYLEFVMEDVAKAVNANYELITPKKE
IERGSQLSVFLHGKGKDLFSYLMNEGVIVDWREPNVVRLAPVPFYTSYEDIYRFGEILKK
ADSLF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgaaaatacacttgcttatgcaaagagcttagatgaaaaagatcctttagct
aagtacagagatgagtttaactttccagaggtaaatggaaaacaggttatatattttaca
ggtaattcgcttggactacaacccaaaagagctgtagagtatgtcaatgaggttatgaat
gattggggggctttagcagtagaggggcatttctacgcagagaaaccttggtgggattac
cacgaacgtttaagtgaaccattgagtagaatagcaggagcgaagtcgtcagaaattaca
gtgatgaatacattgactgttaaccttcacatactgatgactactttttatcgtcctact
gctagtaagtataagattatatgtgaggagaaagcatttccgagtgatcaatatctgata
cagtctcaagtaaggttgcatgggttagaacctaaagaagctattatagagttaaagaaa
agacctggagaacataactttagattagaggatatattagaaaagatagatgaagtagga
gaagaggttgctttagtattaataggaggacttaactattatacagggcaggtgtttgat
atcaaaaccattacagctcatgctcatcaatatggagctaaggtaggatgggatttagct
catgctgctggtaatatagagttaaagttacatgagtggaatgtagatttcgctgcatgg
tgtagttataagtatatgaatgctgggccaggtagtgcatcaggctgtttcattcatgaa
cgttatcatacagataaagatttgattcgattagctggatggtggggacataataaagaa
cgtcgtttcttaatggagaaaaaatttgatgcagtagagagtgcacatggatggcagatt
agtaatccttctattcttagcttagctccttatttagcatctatagagatgttcgatgaa
gtgggaatggaggctttgataacaaaacagagagagattactgcttaccttgaatttgta
atggaggatgtggctaaagcggttaatgctaattatgaattaatcacgcctaaaaaagaa
atcgaaagaggaagtcagctttctgtttttcttcatggaaagggtaaagatctgttttcg
tatttaatgaatgaaggagtaattgtagattggagagagcctaatgtagttaggttagca
ccagttcctttctatacttcttatgaagatatatatcgtttcggagagattctgaaaaaa
gcagatagtcttttttag

DBGET integrated database retrieval system