KEGG   Myroides profundi: MPR_0766Help
Entry
MPR_0766          CDS       T03631                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mpw  Myroides profundi
Pathway
mpw00473  D-Alanine metabolism
mpw00550  Peptidoglycan biosynthesis
mpw01100  Metabolic pathways
mpw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mpw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MPR_0766
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MPR_0766
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MPR_0766
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mpw01011]
    MPR_0766
Enzymes [BR:mpw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MPR_0766
Peptidoglycan biosynthesis and degradation proteins [BR:mpw01011]
 Precursor biosynthesis
  Amino acid ligase
   MPR_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 CPSase_L_D2 GARS_A DUF2777
Motif
Other DBs
NCBI-ProteinID: AJH13961
UniProt: A0A0B5RLN8
LinkDB All DBs
Position
complement(836752..837711)
Genome map
AA seq 319 aa AA seqDB search
MGGYSSEYKISLTSGKVVCETLDRSKYIPYSIHIFENKWVYVDDKNDEFPIDKNDFSVNY
KGNKITFDVVFNAIHGTPGEDGLMQAYFSLIGMPHTSCDYYQAALTMNKRDMLSVLKPFG
IKTAISYYLNEGDVINTEEIIQRVGLPCFVKPNRSGSSFGISKAKTTEELLTAIDLAYKE
DNEIIIESFLNGTEVSVGVIDYQGEIKVLPMTEIVSENDFFDYEAKYLGKSQEITPARID
DKIRDKVADIASRVYTILNMQGFSRSEFIIVDGVPFLLEMNTVPGLTNESILPQQAKAAN
IALADLFDNAIVLALQKAN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggggggatattctagtgaatacaaaatctcattgactagtggtaaagtggtatgcgaa
acactagaccgctctaagtatattccttattcaatacatatctttgaaaacaaatgggtg
tatgtagatgataaaaatgatgaattccctattgataaaaatgacttttcggtaaactat
aaaggcaacaaaatcacttttgatgttgtatttaacgctatacatggtactcctggagaa
gatggattaatgcaagcttatttctctcttatcggaatgcctcatacttcatgtgactac
tatcaagctgctttaacgatgaataaaagagatatgctttctgtcttaaaaccatttggt
attaaaacagctatctcttattatctaaatgaaggagatgttatcaatacagaagaaatt
attcaacgtgttggactgccttgttttgtaaaaccaaatagatctggttctagctttggt
atctcaaaagcaaaaactacagaggaactacttactgccatagacctagcatataaagaa
gataacgagattataatcgaaagcttcttaaatggtacagaggtatctgtcggggttatt
gactatcaaggagaaataaaagtactacctatgacagaaatagtttctgaaaacgacttc
tttgactacgaagctaaatacttaggtaagtctcaagagataactcctgctagaatagat
gataagattagggataaagtagcggatatagctagtagagtatatacaatattaaatatg
caaggcttctcacgcagtgaatttatcattgtagatggagttccatttttattagaaatg
aataccgtaccaggtttaacgaacgaaagtatacttccacaacaagcaaaagcggctaat
attgccctagctgacttgtttgacaatgcaattgttttagctttgcagaaagcaaattaa

DBGET integrated database retrieval system