KEGG   Myroides profundi: MPR_3218Help
Entry
MPR_3218          CDS       T03631                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mpw  Myroides profundi
Brite
Translation factors [BR:mpw03012]
 Eukaryotic Type
  Elongation factors
   MPR_3218
 Prokaryotic Type
   MPR_3218
Mitochondrial biogenesis [BR:mpw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MPR_3218
Exosome [BR:mpw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MPR_3218
  Exosomal proteins of breast cancer cells
   MPR_3218
  Exosomal proteins of colorectal cancer cells
   MPR_3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AJH16343
UniProt: A0A0B5S231
LinkDB All DBs
Position
complement(3582025..3583212)
Genome map
AA seq 395 aa AA seqDB search
MAKETFDRSKPHLNIGTIGHVDHGKTTTTAAITKVLADAGFSEARSFDSIDNAPEEKERG
ITINTSHVEYQTKNRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGIPRIVVFLNKVDLVDDAELLELVEMEVRDLLSFYQYDGDNGPVVQGSALGALN
GEQKWVDALLHLMEEVDAWIEEPVRDNEKPFLMPVEDVFTITGRGTVATGRIETGVANTG
DAVEIIGMGADKLTSTITGVEMFRKILDRGEAGDNVGLLLRGIDKTDIRRGMVICKPGSV
KPHAKFKAEVYILKKEEGGRHTPFHNNYRPQFYVRTTDVTGTIQLPEGVEMVMPGDNLTI
TVELLSPIALSVGLRFAIREGGRTVGAGQVTEIID
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaacttttgatcgttcgaaaccgcacttaaacatcggtactatcggacac
gttgaccacggtaaaactactactactgctgctattactaaagtattagctgacgcagga
ttctcagaagctcgttcatttgattcaattgataatgctccagaagaaaaagagcgtggt
attacaattaatacttctcacgtagagtaccaaacaaaaaaccgtcactatgcacacgtt
gactgtccaggtcacgcggattacgtgaaaaacatggttactggtgctgctcagatggat
ggtgctatcttagtagttgctgctactgatggaccaatgccacaaactcgtgagcacatc
cttttaggacgtcaggtaggtattccaagaatcgttgtattcttaaacaaagttgactta
gttgatgatgctgagttattagaacttgttgagatggaagtaagagatttattatctttc
taccaatacgatggtgataatggaccagtagttcaaggttctgctttaggagcattaaac
ggagagcaaaaatgggttgacgcattattacacttaatggaagaagttgatgcttggatc
gaagagccagtacgtgacaacgagaaaccattcttaatgccagtagaagacgtatttaca
attacaggacgtggaactgttgctacaggacgtatcgaaactggagttgctaatacagga
gatgctgttgaaatcatcggtatgggagctgacaaattaacttctacaattacaggagtt
gagatgttccgtaaaatcttagaccgtggagaagctggagataacgtaggtttattattg
agaggtattgacaaaactgatatccgtcgtggtatggttatttgtaagccaggttcagta
aaaccacacgctaaattcaaagctgaggtttatatcttgaaaaaagaagaaggtggacgt
cacactccattccataacaactaccgtccacagttctacgtacgtacaactgacgtaact
ggaactatccaattaccagaaggagtagagatggttatgcctggagataacttaactatc
actgttgagttattaagcccaatcgctttatcagtaggtttacgtttcgctatccgtgaa
ggaggtagaacagtaggtgctggtcaggtaactgaaattattgactaa

DBGET integrated database retrieval system