KEGG   Myroides profundi: MPR_3399Help
Entry
MPR_3399          CDS       T03631                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mpw  Myroides profundi
Pathway
mpw00473  D-Alanine metabolism
mpw01100  Metabolic pathways
mpw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mpw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MPR_3399
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MPR_3399
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mpw01011]
    MPR_3399
Enzymes [BR:mpw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MPR_3399
Peptidoglycan biosynthesis and degradation proteins [BR:mpw01011]
 Precursor biosynthesis
  Racemase
   MPR_3399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C DNA_pol_A_exo1
Motif
Other DBs
NCBI-ProteinID: AJH16513
UniProt: A0A0B5S2H9
LinkDB All DBs
Position
complement(3772490..3774931)
Genome map
AA seq 813 aa AA seqDB search
MKFNTDAFCSFIGADIIGNSKSEYVDISNISVDSRSLQNDQHTLFFALKGGNHDGHDYIE
ELVNKGVRYIVISDQTKVCPIEGVLFFKVNNTLAALQGAAIFHRDRFDFPVIGITGSKGK
TVVKEWLNYLLSEEYKIIKSPKSYNSQTGVPLSVFGIEEKHNLGIFEVGISTVGEMERLT
KVVKPTIGVFTALTEEHGEGFRSLEEKVSEKAKLFQDAEVVICEQNELLLQYFSSVASVY
TWSLIDKSANVYGQLHSSSLTVSIDQGDSYSVELPFTDDSSVRNIMTCISTMSYLGYDSE
KIAQRIQGLYPVELRMQVKNGVNNCTIIDDAYNADYQSLSIALDFLDKHKVSASKTVILS
DMFKSGYEEEEIYGQLKELLSTHQITRVIGIGEHISKYLIGTTNTYLYRDTEEFLQKVSV
EDFSDENILVKGARGFRFDRIVTMLEKKTHETVLEVNLTAMCHNLNFYRSKLKPETKVMV
MVKAFGYGNGSYEVAKLLAHEKVDYLGVAFADEGIELRKAGVNTKIIVMNPEINAFSAMI
AYDLEPEVYSVRELNAFLKVARERNCYEYPIHIKLDTGMHRHGFLTEDLDELIEVLRHTN
VVEVKSIFSHLSSSDMPEYTDFTLGQIEMFTHNSDKLIQELGINPIRHILNTSGIFNFSE
HQFDMVRLGIGLYGVGNDREEMQQLANVSTLKTRIMQIKEIKDKDSVGYGRRFRAEGKTR
IATVPIGYADGVHRSWGPVGYVLVNGQKAEITGSICMDMLMINVTEIKCQENDEVIIFGK
DLPVTIIADKIKTIPYEILTSIALRVKRIFFIE
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaatacggatgcgttctgttcattcattggagcagacattataggaaacagt
aagagtgaatatgtagatatttcgaatatatccgtagacagcaggtcattgcagaatgat
cagcacactttattttttgcattaaaaggaggtaatcatgatggacatgattatatcgaa
gaattggtaaataaaggagtcagatatatcgtcatctctgaccagactaaggtatgtcct
atagaaggagtacttttctttaaagttaataatacattagctgcacttcagggtgcggct
atttttcatagagatcgttttgattttccagttatcggaattacaggtagtaaaggaaag
acggtagtaaaagaatggcttaactatctactgagcgaagagtataagatcatcaagagc
cctaagagttataattctcagacgggtgtgccactatctgtatttgggatagaggagaag
cacaacttaggtatcttcgaagttggaatttctactgtgggtgaaatggagagacttact
aaggtggtcaaacctactataggtgtttttactgcgcttacagaagagcatggagaaggg
tttcgctcattagaagaaaaagtgagtgagaaagctaaactattccaggatgctgaggtg
gttatttgtgagcagaatgagttgttattacaatattttagttctgttgcctctgtatat
acttggagtctgatagataagtcagctaatgtctatggacagcttcattcctctagtctt
accgtatctattgatcaaggtgattcgtattcagtagaacttccattcacagatgatagt
tctgtgcgtaatataatgacttgtattagtacgatgtcttacttaggatatgactcagag
aagattgcacagcgtatccaaggactttatcctgtagaactgcgtatgcaggtaaagaat
ggtgtgaataactgtacgataatagatgatgcgtataatgcagattatcagtcgctatct
atcgctcttgactttcttgataaacataaggtaagcgcgtctaagactgtgatactatcc
gatatgtttaagagtggatatgaagaagaggaaatatatggtcagttaaaagagctgttg
tctacacatcagataactcgtgtgatcggtataggagaacatataagtaagtatctaatc
gggacgacgaatacttatctatatagagatactgaggagttcttacagaaagtatcggta
gaggattttagtgatgagaatatcttagtcaaaggagctagaggattccgctttgacaga
atcgtcacgatgctagagaagaagacacatgagactgtactagaagttaatcttactgcg
atgtgtcacaatcttaatttttatcgttcaaaactaaagccagagactaaagtaatggtc
atggtgaaggcattcggatatgggaatggtagctatgaagtagcgaaattattagctcat
gagaaggtagattatctaggagtagcttttgcagatgagggtatagaattgcgcaaagct
ggtgtgaatactaagattatcgtgatgaatcctgagattaatgcattctcagcgatgata
gcgtatgatctagaaccagaggtttactctgtacgtgagctcaatgcattcttaaaagta
gctagagaacgcaactgttatgaatatcctatccatatcaagctagatacaggtatgcat
agacatggctttttgacagaggatctagatgagttaatagaagtgcttagacatactaat
gtggtcgaagtcaaatctatattctcacatttatcatcaagtgacatgcctgaatataca
gactttacgcttgggcagatagagatgtttacacataactcagataaattaatacaagaa
ttagggattaatccgatacgccatattctgaatacatccggtatttttaacttttcggag
catcagtttgatatggttcgattgggaataggactgtatggagttggtaatgatagagaa
gaaatgcaacaattggctaatgtcagtacgcttaaaactcgcattatgcaaatcaaagaa
atcaaagataaagacagtgtaggatacggtcgaagatttcgcgcagaaggtaaaacacgt
attgctacagtaccaataggatatgctgatggagtacatcgctcatggggtcctgtggga
tatgtcttagtaaatgggcaaaaagcagagatcactggatctatctgtatggatatgcta
atgatcaatgtaacagaaataaaatgtcaagaaaatgatgaagttattatttttggtaaa
gatctgccagtcactattatagcagataaaataaaaacaataccatatgagattttaacg
agtatcgcacttcgcgttaaaagaattttttttatagagtaa

DBGET integrated database retrieval system