KEGG   Melissococcus plutonius DAT561: MPD5_0408Help
Entry
MPD5_0408         CDS       T01763                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
mpx00473  D-Alanine metabolism
mpx00550  Peptidoglycan biosynthesis
mpx01100  Metabolic pathways
mpx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mpx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MPD5_0408
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MPD5_0408
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MPD5_0408
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mpx01011]
    MPD5_0408
Enzymes [BR:mpx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MPD5_0408
Peptidoglycan biosynthesis and degradation proteins [BR:mpx01011]
 Precursor biosynthesis
  Amino acid ligase
   MPD5_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: BAL61683
LinkDB All DBs
Position
1:453841..454911
Genome map
AA seq 356 aa AA seqDB search
MKIILLYGGKSEEHDVSILSAYSILNAIYYEYYTVQLVLITKQGEWIKGPLLTEKPENKE
ILNLTGAKDENTMAYSSGTSIMPCEIFEKDAIVFPVLHGPNGEDGTIQGFLETIGMPYVG
TGVLASATAMDKIMTKYLLQTVGIPQTPYVPVLKNEWKNDSKQLFERCEGTLLYPMFVKP
ANLGSSVGISKVENREELQKALELAYKYDSRVIVEQGIEAREIEVAILGNEDVRTTLPGE
VVKNVDFYDYQAKYVDNQISMQIPAELPAEVCRQAQEYAKKAYKTLDGSGLSRCDFFLTN
KNELFLNELNTMPGFTEFSMYPSLWENMGLKYSDLIEELIQLGLNRFEQRQRFFNN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattattttattatatggtggtaagagtgaagaacacgatgtatctattctgtct
gcctattctattttgaatgctatttattatgaatattatacagttcaattagttttaatt
acaaaacagggagaatggattaagggaccattacttacagaaaaacctgagaataaagaa
attcttaacttaacgggtgctaaggatgaaaatacaatggcctattcatcaggaacatcc
ataatgccctgtgagatttttgaaaaagatgctattgtatttccagtattacatggacca
aatggtgaagatggtacaattcaaggctttttagaaacaattggtatgccatatgttgga
acaggagtacttgcaagtgcaactgcaatggataaaataatgacaaaatatttgctacaa
accgttggtattcctcaaacaccttatgtgcctgttctaaaaaatgaatggaaaaatgat
tccaagcaattatttgaacggtgtgaaggaaccttgttatatccaatgtttgttaaaccg
gcgaatttaggttcaagtgtaggcatcagtaaggttgaaaatcgagaagaacttcaaaaa
gccttagaactggcttacaaatatgattctcgtgtgattgttgaacaaggcatcgaagca
cgtgaaattgaagtagctattttaggaaatgaagatgtaagaacgactttaccaggagaa
gtagtaaaaaatgttgatttttatgattatcaagccaaatatgtagataatcaaatttct
atgcaaatacctgcagagttaccagctgaagtttgtaggcaagcacaagaatatgcgaaa
aaagcatataaaacattagatggtagtggattaagtcgttgtgatttcttcttaacaaat
aaaaatgaattatttttaaatgaattaaatacaatgcccggttttactgaatttagtatg
tatccatctctttgggagaatatgggattaaagtatagtgatttaattgaggagctaatt
caacttggattaaatcgttttgagcaacgtcaacgtttttttaacaattaa

DBGET integrated database retrieval system