KEGG   Melissococcus plutonius DAT561: MPD5_0442Help
Entry
MPD5_0442         CDS       T01763                                 

Definition
(GenBank) glycosyl transferase, group 2 family protein
Organism
mpx  Melissococcus plutonius DAT561
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Chitin_synth_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: BAL61715
LinkDB All DBs
Position
1:497730..498992
Genome map
AA seq 420 aa AA seqDB search
MTFMDIVMLITIIIIWSLLIINILLVIAGYIYFLKTDKLLPPELEDEKAPFVSIMVPAHN
EGIVIVRTVEALLNFNYPKDHYEIIVINDNSTDNSKELLAEIQATTSEQLLKVINTDNVT
GGKGKSNALNIGFKEARGEFIAIYDADNTPEPNALRYLVGELVNDQEYGAAIGKFRTRNR
HVNLLTRFVNIETLSFQWMAQAGRFQLFKLCTIPGTNFIVRRTILEEIGGWDEKALAEDT
EISFRIYMMGYKIKFQPKAVTWEQEPQTLPVWFKQRTRWVKGNIYVIVKNAKLLFNPQAR
RIWFDIFYFLSVYFLLMTSLVLSDIMLILSVSGYLHTTLEGFSNSLWLLAVILFIFSTYV
SITTEKGELNLHNLLIIALMYISYSQMWLVTAAYGMVMYIREAIFHKKTPNKWYKTERFK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacatttatggatatagtaatgttaataacaataattattatttggtctttactaatt
attaatattttattagtcattgctggttacatctattttttaaagacggataaattactt
cctcctgaattagaagacgaaaaagcaccttttgtatctattatggtacctgcacataat
gaaggaattgttattgtacgaacggtagaggctttactgaactttaactatccaaaagat
cattatgaaattattgtaatcaacgataattctacagataatagcaaggaattattagca
gagattcaagcaacaacttctgaacaattattaaaggtaatcaatacagataatgtaaca
ggtggtaagggaaaatctaatgcactaaatatcggatttaaagaagcaaggggagaattt
attgcgatttatgatgctgacaatactcctgaaccgaatgcacttcgttatttggtagga
gaattggttaatgaccaagaatacggggcagctattggaaaatttagaacaagaaatagg
catgtaaacttgctaactcgttttgttaatattgagactttatcttttcaatggatggca
caggcaggacgttttcagctatttaagttatgtactatacctggaacaaattttattgtt
agacgaaccattcttgaagaaattggtggttgggatgagaaggctttagcagaagataca
gaaattagttttcgaatttatatgatgggctataaaattaaatttcaaccaaaggcagtt
acctgggaacaagaaccacagacattgccggtttggtttaaacaacggacacgttgggta
aaaggaaatatttatgtgattgttaaaaatgctaaattattatttaatccgcaagctcgc
cgaatctggtttgatattttttattttttatcggtttactttcttttaatgacatcttta
gtgttatccgatattatgttgattttatccgtctctggttacctacatacaacccttgaa
ggatttagtaattccctatggttattagcggtaattttgtttatttttagtacgtatgtt
agtatcacaaccgaaaaaggagaattaaatctacataatttgttaatcattgctttaatg
tatattagttatagtcaaatgtggctagtaactgctgcctatggtatggttatgtatatt
cgtgaggcgatctttcataaaaaaacaccaaataaatggtataaaacagaacgttttaaa
taa

DBGET integrated database retrieval system