KEGG   Melissococcus plutonius DAT561: MPD5_1269Help
Entry
MPD5_1269         CDS       T01763                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
mpx00500  Starch and sucrose metabolism
mpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPD5_1269
Enzymes [BR:mpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MPD5_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: BAL62485
UniProt: H5T5P2
LinkDB All DBs
Position
1:complement(1420799..1422295)
Genome map
AA seq 498 aa AA seqDB search
MEKKQRTLLQGFEWYLPEDQYHWQKIAELAPLLKQIGFTSIWLPPAYKGLKGEKEVGYAP
YDLYDLGEFQQQGTIATKYGTKDEYLACIHALKENDLEVLADIVFDHFMGADEKEKVLAE
RCKATDREAIISEQRMIEARTKFTFSGRKGKYDNYQWSWKNFSGVDYDDKQKEEGIFKFV
GKKWNSPVDNENANFDYLMGCNLDMTYPETIQQLDNWGKWYQSITDIDGYRFDAVKHIKF
DFFNQWLLHRRKEKEQELFIIGEYWNNDLQKLENYIDQSGALLPLFDVPLHYNFYEAAKK
GNQYDLRKLLVNTLVDSRPEWAITFVENHDTQEGQSLESWVLPWFKPMAYAIILLLMKGT
PVVFWGDLFGIPAKKVEKMGQTLIILLKIRQQIRSNYELTYFDDPTIVGWTHVDSLNERD
FNYAVIMSNDQNGSKQMCIGTRAAHKNYIDILGNHHQIVRLNEVGIGNFYVKERSLAVYV
EETVAKKLLAEVEQLDIK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaaacagcgaaccttattacaaggatttgaatggtatttacctgaagatcag
tatcattggcaaaaaatagccgagttggctcctttattaaagcagataggatttactagt
atctggctgcctccagcatataaaggcttaaagggtgaaaaagaagtcggttatgctcct
tatgatttatatgatttaggcgaatttcaacagcaaggtacaattgctaccaagtatggg
acaaaagatgagtatttagcatgtattcatgctcttaaggaaaatgatttagaagttttg
gcagatattgtttttgatcattttatgggagcagatgaaaaagaaaaagtcttggcagaa
cgttgcaaagcaacagatcgtgaagcgataatttctgaacaaagaatgatagaagccaga
acaaaatttactttttcaggcagaaaaggaaaatatgataactatcaatggtcttggaaa
aatttctctggtgttgattatgatgataaacaaaaagaagaaggaatttttaaatttgta
ggaaaaaaatggaattcgccggttgataatgaaaatgctaattttgattatttaatggga
tgtaatttggatatgacttatcctgaaacaattcagcaattggacaattggggaaagtgg
tatcaatccataacagatatagatggttatcgttttgatgcagtgaaacatattaaattt
gattttttcaatcaatggttattgcatcgtagaaaagaaaaagagcaagaattatttata
ataggcgaatattggaataacgatttacagaagctggaaaattatattgatcaatccggt
gcattacttcctttgtttgatgttcctcttcattataacttttatgaagctgcaaaaaaa
ggcaatcaatatgatttacgaaaattattggtgaatacattggtagattctcgtccagaa
tgggcgataacttttgtcgaaaatcatgatacacaggaaggacaaagcttggaatcttgg
gtacttccttggtttaaaccaatggcttatgcaattattttattacttatgaaaggtaca
ccagtggttttttggggtgatttatttggtataccggcaaaaaaggttgaaaaaatgggc
caaacattgatcattttactgaaaattcgccagcaaattcgttccaattatgaactaacc
tattttgacgatccaacaattgttggatggacacatgtcgattcgttaaatgagagggac
tttaattatgcggtaattatgtcaaacgatcaaaatggtagtaagcaaatgtgtatagga
acacgagcagcacataaaaattatattgatattctaggaaatcatcatcagatagttaga
ttaaatgaagtaggaattggaaacttttatgtaaaggagagatcgttagctgtttatgta
gaggaaacagttgctaaaaaattattagctgaagtagaacaattagatattaagtaa

DBGET integrated database retrieval system